Recombinant Human RTRAF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RTRAF-2316H
Product Overview : C14orf166 MS Standard C13 and N15-labeled recombinant protein (NP_057123) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport.
Molecular Mass : 28.1 kDa
AA Sequence : MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RTRAF RNA transcription, translation and transport factor [ Homo sapiens (human) ]
Official Symbol RTRAF
Synonyms RTRAF; RNA transcription, translation and transport factor; CLE; CLE7; hCLE; CGI99; RLLM1; hCLE1; CGI-99; LCRP369; C14orf166; RNA transcription, translation and transport factor protein; CLE7 homolog; RLL motif containing 1; UPF0568 protein C14orf166
Gene ID 51637
mRNA Refseq NM_016039
Protein Refseq NP_057123
MIM 610858
UniProt ID Q9Y224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTRAF Products

Required fields are marked with *

My Review for All RTRAF Products

Required fields are marked with *

0
cart-icon
0
compare icon