Recombinant Human RUNX1 protein, Arginine-tagged
Cat.No. : | RUNX1-148H |
Product Overview : | Recombinant human RUNX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | RIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLP THWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTIT VFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASL NHSTAFNPQPQSQMQEEDTAPWRCLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for hematopoietic cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | RUNX1 runt-related transcription factor 1 [ Homo sapiens ] |
Official Symbol | RUNX1 |
Synonyms | RUNX1; runt-related transcription factor 1; acute myeloid leukemia 1 , AML1, CBFA2; aml1 oncogene; AMLCR1; PEBP2A2; CBF-alpha-2; PEA2-alpha B; PEBP2-alpha B; AML1; CBFA2; EVI-1; PEBP2aB; AML1-EVI-1; |
Gene ID | 861 |
mRNA Refseq | NM_001001890 |
Protein Refseq | NP_001001890 |
MIM | 151385 |
UniProt ID | Q01196 |
Chromosome Location | 21q22.3 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Pathways in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; |
Function | ATP binding; DNA binding; calcium ion binding; protein binding; protein heterodimerization activity; protein homodimerization activity; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription factor binding; |
◆ Recombinant Proteins | ||
RUNX1-27497TH | Recombinant Human RUNX1 | +Inquiry |
Runx1-783M | Recombinant Mouse Runx1 Protein, MYC/DDK-tagged | +Inquiry |
RUNX1-1928H | Recombinant Human RUNX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RUNX1-2471H | Recombinant Human RUNX1, GST-tagged | +Inquiry |
RUNX1-188HFL | Active Recombinant Full Length Human RUNX1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX1-2112HCL | Recombinant Human RUNX1 293 Cell Lysate | +Inquiry |
RUNX1-2111HCL | Recombinant Human RUNX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RUNX1 Products
Required fields are marked with *
My Review for All RUNX1 Products
Required fields are marked with *