"RUNX1" Related Products

Expand
Expand
Expand

Recombinant Human RUNX1 protein, Arginine-tagged

Cat.No.: RUNX1-148H
Product Overview: Recombinant human RUNX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: RIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLP THWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTIT VFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASL NHSTAFNPQPQSQMQEEDTAPWRCLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for hematopoietic cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: RUNX1 runt-related transcription factor 1 [ Homo sapiens ]
Official Symbol: RUNX1
Synonyms: RUNX1; runt-related transcription factor 1; acute myeloid leukemia 1 , AML1, CBFA2; aml1 oncogene; AMLCR1; PEBP2A2; CBF-alpha-2; PEA2-alpha B; PEBP2-alpha B; AML1; CBFA2; EVI-1; PEBP2aB; AML1-EVI-1;
Gene ID: 861
mRNA Refseq: NM_001001890
Protein Refseq: NP_001001890
MIM: 151385
UniProt ID: Q01196
Chromosome Location: 21q22.3
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Pathways in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem;
Function: ATP binding; DNA binding; calcium ion binding; protein binding; protein heterodimerization activity; protein homodimerization activity; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.