Recombinant Human RUNX1 protein, Arginine-tagged

Cat.No. : RUNX1-148H
Product Overview : Recombinant human RUNX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : RIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLP THWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTIT VFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASL NHSTAFNPQPQSQMQEEDTAPWRCLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for hematopoietic cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name RUNX1 runt-related transcription factor 1 [ Homo sapiens ]
Official Symbol RUNX1
Synonyms RUNX1; runt-related transcription factor 1; acute myeloid leukemia 1 , AML1, CBFA2; aml1 oncogene; AMLCR1; PEBP2A2; CBF-alpha-2; PEA2-alpha B; PEBP2-alpha B; AML1; CBFA2; EVI-1; PEBP2aB; AML1-EVI-1;
Gene ID 861
mRNA Refseq NM_001001890
Protein Refseq NP_001001890
MIM 151385
UniProt ID Q01196
Chromosome Location 21q22.3
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Pathways in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem;
Function ATP binding; DNA binding; calcium ion binding; protein binding; protein heterodimerization activity; protein homodimerization activity; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RUNX1 Products

Required fields are marked with *

My Review for All RUNX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon