Recombinant Human RUNX2
Cat.No. : | RUNX2-30473TH |
Product Overview : | Recombinant fragment corresponding to amino acids 251-350 of Human RUNX2 with a proprietary tag at N-terminal; predicted MWT 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Specifically expressed in osteoblasts. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA |
Sequence Similarities : | Contains 1 Runt domain. |
Gene Name | RUNX2 runt-related transcription factor 2 [ Homo sapiens ] |
Official Symbol | RUNX2 |
Synonyms | RUNX2; runt-related transcription factor 2; CBFA1, CCD, CCD1; AML3; PEBP2A1; PEBP2aA1; |
Gene ID | 860 |
mRNA Refseq | NM_001015051 |
Protein Refseq | NP_001015051 |
MIM | 600211 |
Uniprot ID | Q13950 |
Chromosome Location | 6p21 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; |
Function | ATP binding; DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
RUNX2-28321TH | Recombinant Human RUNX2 | +Inquiry |
RUNX2-48H | Recombinant Human RUNX2 protein, His-tagged | +Inquiry |
Runx2-5723M | Recombinant Mouse Runx2 protein, His-tagged | +Inquiry |
RUNX2-5704C | Recombinant Chicken RUNX2 | +Inquiry |
RUNX2-6644H | Recombinant Human RUNX2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX2-2108HCL | Recombinant Human RUNX2 293 Cell Lysate | +Inquiry |
RUNX2-2107HCL | Recombinant Human RUNX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RUNX2 Products
Required fields are marked with *
My Review for All RUNX2 Products
Required fields are marked with *
0
Inquiry Basket