Recombinant Human RUNX3 protein, GST-tagged

• Cat.No.: RUNX3-7854H
• Product Overview: Recombinant Human RUNX3 protein(207-251 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 207-251 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: PFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTS
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RUNX3 runt-related transcription factor 3 [ Homo sapiens ]
• Official Symbol: RUNX3
• Synonyms: RUNX3; runt-related transcription factor 3; CBFA3; AML2; PEBP2A3; CBF-alpha-3; PEA2 alpha C; PEA2-alpha C; PEBP2 alpha C; PEBP2-alpha C; oncogene AML-2; transcription factor AML2; acute myeloid leukemia gene 2; acute myeloid leukemia 2 protein; core-binding factor subunit alpha-3; SL3-3 enhancer factor 1 alpha C subunit; SL3/AKV core-binding factor alpha C subunit; core-binding factor, runt domain, alpha subunit 3; polyomavirus enhancer-binding protein 2 alpha C subunit; PEBP2aC; FLJ34510; MGC16070
• mRNA Refseq: NM_001031680
• Protein Refseq: NP_001026850
• MIM: 600210
• UniProt ID: Q13761
• Gene ID: 864