Recombinant Human RUVBL2, His-tagged

Cat.No. : RUVBL2-30950TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-463 of Human Reptin/TIP49B/RUVB2 with a N terminal His tag; MWt 58 ;
Availability October 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-463 a.a.
Description : This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.
Conjugation : HIS
Tissue specificity : Ubiquitously expressed. Highly expressed in testis and thymus.
Form : Lyophilised:Reconstitution with 139 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPR QASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQ PGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKT EALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGS KVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVIT IDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGEL QKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKS EVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFS FLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPI DLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDA YTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
Sequence Similarities : Belongs to the ruvB family.
Full Length : Full L.
Publications :
Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens (2023)
Gene Name RUVBL2 RuvB-like 2 (E. coli) [ Homo sapiens ]
Official Symbol RUVBL2
Synonyms RUVBL2; RuvB-like 2 (E. coli); RuvB (E coli homolog) like 2; ruvB-like 2; ECP51; INO80 complex subunit J; INO80J; reptin; Reptin52; Rvb2; RVB2; TIH2; TIP48; TIP49b;
Gene ID 10856
mRNA Refseq NM_006666
Protein Refseq NP_006657
MIM 604788
Uniprot ID Q9Y230
Chromosome Location 19q13.3
Pathway ATF-2 transcription factor network, organism-specific biosystem; C-MYC pathway, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Extension of Telomeres, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function ATP binding; ATP-dependent DNA helicase activity; contributes_to ATPase activity; DNA helicase activity; damaged DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RUVBL2 Products

Required fields are marked with *

My Review for All RUVBL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon