Recombinant Full Length Human RUVBL2 Protein, His-tagged

• Cat.No.: RUVBL2-30950TH
• Product Overview: RUVBL2;RuvB like AAA ATPase 2;RVB2;TIH2;ECP51;TIP48;CGI-46;ECP-51;INO80J;REPTIN;TIP49B;TAP54-beta;His-tagged;Human

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-463 aa
• Description: RUVBL2 (RuvB like AAA ATPase 2), also known as RVB2, TIP48, or REPTIN, is the second human homolog of the bacterial RuvB gene. The bacterial RuvB protein is a DNA helicase essential for homologous recombination and double-strand break repair. RUVBL2 possesses both ATPase and DNA helicase activities and functions in chromatin remodeling, transcription regulation, DNA repair, snoRNP assembly, and Wnt signaling pathway regulation.
• Form: Liquid
• Molecular Mass: 53 kDa (calculated)
• AASequence: MGSSHHHHHHSSGLVPRGSHMATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
• Endotoxin: <1.0 EU/ug (by LAL)
• Purity: >90% (by SDS-PAGE)
• Storage: Store under sterile conditions at -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles
• Concentration: 1 mg/ml (by BCA)
• Labeling Efficiency: Sterile PBS, pH7.4, 0.1% SKL
• Publications:
  • Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens (2023)

Gene Information

• Gene Name: RUVBL2
• Official Symbol: NM_006666.3
• Synonyms: NP_006657.1
• Gene ID: https://www.ncbi.nlm.nih.gov/protein/NP_006657.1
• mRNA Refseq: https://www.uniprot.org/uniprotkb/Q9Y230
• Protein Refseq: https://www.ncbi.nlm.nih.gov/gene/10856
• MIM: https://www.omim.org/entry/604788