Recombinant Full Length Human RUVBL2 Protein, His-tagged

Cat.No. : RUVBL2-30950TH
Product Overview : RUVBL2;RuvB like AAA ATPase 2;RVB2;TIH2;ECP51;TIP48;CGI-46;ECP-51;INO80J;REPTIN;TIP49B;TAP54-beta;His-tagged;Human
Availability October 02, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 1-463 aa
Description : RUVBL2 (RuvB like AAA ATPase 2), also known as RVB2, TIP48, or REPTIN, is the second human homolog of the bacterial RuvB gene. The bacterial RuvB protein is a DNA helicase essential for homologous recombination and double-strand break repair. RUVBL2 possesses both ATPase and DNA helicase activities and functions in chromatin remodeling, transcription regulation, DNA repair, snoRNP assembly, and Wnt signaling pathway regulation.
Form : Liquid
Molecular Mass : 53 kDa (calculated)
AASequence : MGSSHHHHHHSSGLVPRGSHMATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
Endotoxin : <1.0 EU/ug (by LAL)
Purity : >90% (by SDS-PAGE)
Storage : Store under sterile conditions at -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles
Concentration : 1 mg/ml (by BCA)
Labeling Efficiency : Sterile PBS, pH7.4, 0.1% SKL
Publications :

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RUVBL2 Products

Required fields are marked with *

My Review for All RUVBL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon