Recombinant Human RUVBL2, His-tagged
| Cat.No. : | RUVBL2-30950TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-463 of Human Reptin/TIP49B/RUVB2 with a N terminal His tag; MWt 58 ; |
| Availability | June 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-463 a.a. |
| Description : | This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation. |
| Conjugation : | HIS |
| Tissue specificity : | Ubiquitously expressed. Highly expressed in testis and thymus. |
| Form : | Lyophilised:Reconstitution with 139 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPR QASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQ PGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKT EALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGS KVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVIT IDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGEL QKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKS EVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFS FLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPI DLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDA YTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS |
| Sequence Similarities : | Belongs to the ruvB family. |
| Full Length : | Full L. |
| Publications : |
| Gene Name | RUVBL2 RuvB-like 2 (E. coli) [ Homo sapiens ] |
| Official Symbol | RUVBL2 |
| Synonyms | RUVBL2; RuvB-like 2 (E. coli); RuvB (E coli homolog) like 2; ruvB-like 2; ECP51; INO80 complex subunit J; INO80J; reptin; Reptin52; Rvb2; RVB2; TIH2; TIP48; TIP49b; |
| Gene ID | 10856 |
| mRNA Refseq | NM_006666 |
| Protein Refseq | NP_006657 |
| MIM | 604788 |
| Uniprot ID | Q9Y230 |
| Chromosome Location | 19q13.3 |
| Pathway | ATF-2 transcription factor network, organism-specific biosystem; C-MYC pathway, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Extension of Telomeres, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
| Function | ATP binding; ATP-dependent DNA helicase activity; contributes_to ATPase activity; DNA helicase activity; damaged DNA binding; |
| ◆ Recombinant Proteins | ||
| RUVBL2-4056R | Recombinant Rhesus monkey RUVBL2 Protein, His-tagged | +Inquiry |
| RUVBL2-2476H | Recombinant Human RUVBL2, GST-tagged | +Inquiry |
| RUVBL2-1360H | Recombinant Human RUVBL2 Protein, His-SUMO-tagged | +Inquiry |
| RUVBL2-3873R | Recombinant Rhesus Macaque RUVBL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RUVBL2-1181HFL | Recombinant Full Length Human RUVBL2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RUVBL2-2104HCL | Recombinant Human RUVBL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RUVBL2 Products
Required fields are marked with *
My Review for All RUVBL2 Products
Required fields are marked with *
