Recombinant Human RXFP2 protein, His&Myc-tagged
Cat.No. : | RXFP2-5733H |
Product Overview : | Recombinant Human RXFP2 protein(Q8WXD0)(33-158aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 33-158a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFI |
Gene Name | RXFP2 relaxin/insulin-like family peptide receptor 2 [ Homo sapiens ] |
Official Symbol | RXFP2 |
Synonyms | RXFP2; relaxin/insulin-like family peptide receptor 2; leucine rich repeat containing G protein coupled receptor 8 , LGR8; relaxin receptor 2; GPR106; GREAT; INSL3R; RXFPR2; G-protein coupled receptor 106; relaxin family peptide receptor 2; G protein coupled receptor affecting testicular descent; G-protein coupled receptor affecting testicular descent; leucine-rich repeat-containing G protein-coupled receptor 8; leucine-rich repeat-containing G-protein coupled receptor 8; LGR8; LGR8.1; |
Gene ID | 122042 |
mRNA Refseq | NM_001166058 |
Protein Refseq | NP_001159530 |
MIM | 606655 |
UniProt ID | Q8WXD0 |
◆ Cell & Tissue Lysates | ||
RXFP2-2099HCL | Recombinant Human RXFP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RXFP2 Products
Required fields are marked with *
My Review for All RXFP2 Products
Required fields are marked with *
0
Inquiry Basket