Recombinant Human RXFP2 protein, His&Myc-tagged

• Cat.No.: RXFP2-5733H
• Product Overview: Recombinant Human RXFP2 protein(Q8WXD0)(33-158aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 33-158a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.1 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: FALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFI

Gene Information

• Gene Name: RXFP2 relaxin/insulin-like family peptide receptor 2 [ Homo sapiens ]
• Official Symbol: RXFP2
• Synonyms: RXFP2; relaxin/insulin-like family peptide receptor 2; leucine rich repeat containing G protein coupled receptor 8 , LGR8; relaxin receptor 2; GPR106; GREAT; INSL3R; RXFPR2; G-protein coupled receptor 106; relaxin family peptide receptor 2; G protein coupled receptor affecting testicular descent; G-protein coupled receptor affecting testicular descent; leucine-rich repeat-containing G protein-coupled receptor 8; leucine-rich repeat-containing G-protein coupled receptor 8; LGR8; LGR8.1
• Gene ID: 122042
• mRNA Refseq: NM_001166058
• Protein Refseq: NP_001159530
• MIM: 606655
• UniProt ID: Q8WXD0