Recombinant Human RYK

Cat.No. : RYK-31340TH
Product Overview : Recombinant fragment of Human RYK with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. Two alternative splice variants have been identified, encoding distinct isoforms.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Observed in all the tissues examined.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISH YALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAM DMPQVNISVQGEVPRTLSVFRVELSCTGKV
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family.Contains 1 protein kinase domain.Contains 1 WIF domain.
Gene Name RYK RYK receptor-like tyrosine kinase [ Homo sapiens ]
Official Symbol RYK
Synonyms RYK; RYK receptor-like tyrosine kinase; JTK5A, JTK5A protein tyrosine kinase; tyrosine-protein kinase RYK; D3S3195; JTK5; RYK1;
Gene ID 6259
mRNA Refseq NM_002958
Protein Refseq NP_002949
MIM 600524
Uniprot ID P34925
Chromosome Location 3q22.1
Pathway Wnt signaling network, organism-specific biosystem;
Function ATP binding; Wnt-protein binding; frizzled binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RYK Products

Required fields are marked with *

My Review for All RYK Products

Required fields are marked with *

0
cart-icon