Recombinant Human RYK

• Cat.No.: RYK-31340TH
• Product Overview: Recombinant fragment of Human RYK with N terminal proprietary tag, 37.73kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. Two alternative splice variants have been identified, encoding distinct isoforms.
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Observed in all the tissues examined.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISH YALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAM DMPQVNISVQGEVPRTLSVFRVELSCTGKV
• Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family.Contains 1 protein kinase domain.Contains 1 WIF domain.

Gene Information

• Gene Name: RYK RYK receptor-like tyrosine kinase [ Homo sapiens ]
• Official Symbol: RYK
• Synonyms: RYK; RYK receptor-like tyrosine kinase; JTK5A, JTK5A protein tyrosine kinase; tyrosine-protein kinase RYK; D3S3195; JTK5; RYK1
• Gene ID: 6259
• mRNA Refseq: NM_002958
• Protein Refseq: NP_002949
• MIM: 600524
• Uniprot ID: P34925
• Chromosome Location: 3q22.1
• Pathway: Wnt signaling network, organism-specific biosystem
• Function: ATP binding; Wnt-protein binding; frizzled binding; nucleotide binding; protein binding