Recombinant Human S100A1 Protein (101 aa), His-tagged
Cat.No. : | S100A1-314S |
Product Overview : | Recombinant S100 calcium-binding protein A1 (S100A1) with His tag produced in E. coli is a single chain containing 101 amino acids with molecular mass of 11.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 101 |
Description : | S100 calcium-binding protein A1 (S100A1) is a small calcium binding protein with EF-hand structures and belongs to the S100 family. S100 proteins include at least 25 members which are located as a cluster on human chromosome 1q21. S100A1 is found in the heart, skeletal muscle, brain, and kidney.S100A1 mainly resides on the sarcoplasmic reticulum, mitochondria and myofilaments. S100A1 may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Molecular Mass : | 11.5 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MHHHHHHMGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant S100 calcium- binding protein A1 (S100A1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, S100A1 should be stable up to 2 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 20 mM Tris-HCl, 0.1 mM EDTA, pH7.0. |
Reconstitution : | Reconstituted in ddH2O at 200 μg/mL. |
Gene Name | S100A1 S100 calcium binding protein A1 [ Homo sapiens ] |
Official Symbol | S100A1 |
Synonyms | S100A1; S100 calcium binding protein A1; S100 calcium binding protein A1, S100A; protein S100-A1; S100 alpha; S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100; S100A; S100-alpha; |
Gene ID | 6271 |
mRNA Refseq | NM_006271 |
Protein Refseq | NP_006262 |
MIM | 176940 |
UniProt ID | P23297 |
◆ Recombinant Proteins | ||
S100A1-5506Z | Recombinant Zebrafish S100A1 | +Inquiry |
S100A1-322H | Recombinant Human S100A1 protein, His/MBP-tagged | +Inquiry |
S100A1-841H | Active Recombinant Human S100A1 protein(Gly2-Ser94), hFc-tagged | +Inquiry |
S100A1-14610M | Recombinant Mouse S100A1 Protein | +Inquiry |
S100a1-7012M | Recombinant Mouse S100A1 protein(Gly2-Ser94), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A1-2861HCL | Recombinant Human S100A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A1 Products
Required fields are marked with *
My Review for All S100A1 Products
Required fields are marked with *
0
Inquiry Basket