Recombinant Human S100A10 protein, His&Myc-tagged
Cat.No. : | S100A10-3458H |
Product Overview : | Recombinant Human S100A10 protein(P60903)(1-97aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-97aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100A10 S100 calcium binding protein A10 [ Homo sapiens ] |
Official Symbol | S100A10 |
Synonyms | S100A10; S100 calcium binding protein A10; ANX2LG, CAL1L, S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)) , S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); protein S100-A10; 42C; annexin II tetramer (AIIt) p11 subunit; CLP11; P11; calpactin I light chain; calpactin-1 light chain; cellular ligand of annexin II; annexin II ligand, calpactin I, light polypeptide; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); p10; GP11; ANX2L; CAL1L; Ca[1]; ANX2LG; MGC111133; |
Gene ID | 6281 |
mRNA Refseq | NM_002966 |
Protein Refseq | NP_002957 |
MIM | 114085 |
UniProt ID | P60903 |
◆ Recombinant Proteins | ||
S100A10-1255H | Recombinant Human S100A10 protein, His-tagged | +Inquiry |
S100A10-434H | Recombinant Human S100A10, His-tagged | +Inquiry |
S100A10-7055C | Recombinant Chicken S100A10 | +Inquiry |
S100A10-4021H | Recombinant Human S100A10 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A10-7864M | Recombinant Mouse S100A10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A10-2096HCL | Recombinant Human S100A10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A10 Products
Required fields are marked with *
My Review for All S100A10 Products
Required fields are marked with *