Recombinant Human S100A12 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A12-063H
Product Overview : S100A12 MS Standard C13 and N15-labeled recombinant protein (NP_005612) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.
Molecular Mass : 10.6 kDa
AA Sequence : MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A12 S100 calcium binding protein A12 [ Homo sapiens (human) ]
Official Symbol S100A12
Synonyms S100A12; S100 calcium binding protein A12; CAAF1; CAGC; CGRP; ENRAGE; MRP-6; MRP6; p6; protein S100-A12; EN-RAGE; calcitermin; calcium-binding protein in amniotic fluid 1; calgranulin C; extracellular newly identified RAGE-binding protein; migration inhibitory factor-related protein 6; neutrophil S100 protein
Gene ID 6283
mRNA Refseq NM_005621
Protein Refseq NP_005612
MIM 603112
UniProt ID P80511

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A12 Products

Required fields are marked with *

My Review for All S100A12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon