Recombinant Human S100A16 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | S100A16-1977H |
| Product Overview : | S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Calcium-binding protein. Binds one calcium ion per monomer. Can promote differentiation of adipocytes. Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake. |
| Molecular Mass : | 11.6 kDa |
| AA Sequence : | MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | S100A16 S100 calcium binding protein A16 [ Homo sapiens (human) ] |
| Official Symbol | S100A16 |
| Synonyms | S100A16; S100 calcium binding protein A16; protein S100-A16; DT1P1A7; MGC17528; S100F; protein S100-F; aging-associated protein 13; S100 calcium-binding protein A16; aging-associated gene 13 protein; AAG13; |
| Gene ID | 140576 |
| mRNA Refseq | NM_080388 |
| Protein Refseq | NP_525127 |
| MIM | 617437 |
| UniProt ID | Q96FQ6 |
| ◆ Recombinant Proteins | ||
| S100A16-436H | Recombinant Human S100 Calcium Binding Protein A16 | +Inquiry |
| S100A16-5654H | Recombinant Human S100A16 Protein (Ser2-Ser103), N-His tagged | +Inquiry |
| S100A16-2486H | Recombinant Human S100A16, GST-tagged | +Inquiry |
| S100A16-3509H | Recombinant Human S100 Aalcium Binding Protein A16, His-tagged | +Inquiry |
| S100A16-1977H | Recombinant Human S100A16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A16-2091HCL | Recombinant Human S100A16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A16 Products
Required fields are marked with *
My Review for All S100A16 Products
Required fields are marked with *
