Recombinant Human S100A16 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100A16-1977H
Product Overview : S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Calcium-binding protein. Binds one calcium ion per monomer. Can promote differentiation of adipocytes. Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake.
Molecular Mass : 11.6 kDa
AA Sequence : MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100A16 S100 calcium binding protein A16 [ Homo sapiens (human) ]
Official Symbol S100A16
Synonyms S100A16; S100 calcium binding protein A16; protein S100-A16; DT1P1A7; MGC17528; S100F; protein S100-F; aging-associated protein 13; S100 calcium-binding protein A16; aging-associated gene 13 protein; AAG13;
Gene ID 140576
mRNA Refseq NM_080388
Protein Refseq NP_525127
MIM 617437
UniProt ID Q96FQ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A16 Products

Required fields are marked with *

My Review for All S100A16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon