Recombinant Human S100A16 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A16-1977H |
Product Overview : | S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Calcium-binding protein. Binds one calcium ion per monomer. Can promote differentiation of adipocytes. Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake. |
Molecular Mass : | 11.6 kDa |
AA Sequence : | MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A16 S100 calcium binding protein A16 [ Homo sapiens (human) ] |
Official Symbol | S100A16 |
Synonyms | S100A16; S100 calcium binding protein A16; protein S100-A16; DT1P1A7; MGC17528; S100F; protein S100-F; aging-associated protein 13; S100 calcium-binding protein A16; aging-associated gene 13 protein; AAG13; |
Gene ID | 140576 |
mRNA Refseq | NM_080388 |
Protein Refseq | NP_525127 |
MIM | 617437 |
UniProt ID | Q96FQ6 |
◆ Recombinant Proteins | ||
S100A16-3509H | Recombinant Human S100 Aalcium Binding Protein A16, His-tagged | +Inquiry |
S100A16-1977H | Recombinant Human S100A16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100a16-7902R | Recombinant Rat S100a16 protein, His & T7-tagged | +Inquiry |
S100a16-5668M | Recombinant Mouse S100a16 Protein, Myc/DDK-tagged | +Inquiry |
S100A16-3724H | Recombinant Human S100A16, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A16-2091HCL | Recombinant Human S100A16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A16 Products
Required fields are marked with *
My Review for All S100A16 Products
Required fields are marked with *
0
Inquiry Basket