Recombinant Human S100B protein, GST-tagged
Cat.No. : | S100B-3633H |
Product Overview : | Recombinant Human S100B protein(50 - 92 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 50 - 92 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | EQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | S100B S100 calcium binding protein B [ Homo sapiens ] |
Official Symbol | S100B |
Synonyms | S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta; S-100 protein subunit beta; S-100 calcium-binding protein, beta chain; S100 calcium-binding protein, beta (neural); NEF; S100; S100-B; |
Gene ID | 6285 |
mRNA Refseq | NM_006272 |
Protein Refseq | NP_006263 |
MIM | 176990 |
UniProt ID | P04271 |
◆ Recombinant Proteins | ||
S100b-2570M | Recombinant Mouse S100b protein, His-tagged | +Inquiry |
S100B-31009TH | Recombinant Full Length Human S100B Protein | +Inquiry |
S100b-7332M | Recombinant Mouse S100b Protein, His-tagged | +Inquiry |
S100B-323H | Recombinant Human S100B protein, His/MBP-tagged | +Inquiry |
S100B-5623C | Recombinant Chicken S100B | +Inquiry |
◆ Native Proteins | ||
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100B Products
Required fields are marked with *
My Review for All S100B Products
Required fields are marked with *