Recombinant Human S100B protein, GST-tagged
Cat.No. : | S100B-3633H |
Product Overview : | Recombinant Human S100B protein(50 - 92 aa), fused to GST tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Protein length : | 50 - 92 aa |
AA Sequence : | EQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | S100B S100 calcium binding protein B [ Homo sapiens ] |
Official Symbol : | S100B |
Synonyms : | S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta; S-100 protein subunit beta; S-100 calcium-binding protein, beta chain; S100 calcium-binding protein, beta (neural); NEF; S100; S100-B; |
Gene ID : | 6285 |
mRNA Refseq : | NM_006272 |
Protein Refseq : | NP_006263 |
MIM : | 176990 |
UniProt ID : | P04271 |
Products Types
◆ Recombinant Protein | ||
S100B-3882R | Recombinant Rhesus Macaque S100B Protein, His (Fc)-Avi-tagged | +Inquiry |
S100B-227H | Recombinant Human S100B Protein, MYC/DDK-tagged | +Inquiry |
S100B-68H | Active Recombinant Human S100B protein(Ser2-Glu92), hFc-tagged | +Inquiry |
S100B-5482R | Recombinant Rhesus Macaque S100 Calcium Binding Protein B | +Inquiry |
S100B-31010TH | Active Recombinant Human S100B protein(Ser2-Glu92), His-tagged | +Inquiry |
◆ Native Protein | ||
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
◆ Lysates | ||
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket