Recombinant Human S100B protein, GST-tagged

• Cat.No.: S100B-3633H
• Product Overview: Recombinant Human S100B protein(50 - 92 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 50 - 92 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: EQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: S100B S100 calcium binding protein B [ Homo sapiens ]
• Official Symbol: S100B
• Synonyms: S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta; S-100 protein subunit beta; S-100 calcium-binding protein, beta chain; S100 calcium-binding protein, beta (neural); NEF; S100; S100-B
• Gene ID: 6285
• mRNA Refseq: NM_006272
• Protein Refseq: NP_006263
• MIM: 176990
• UniProt ID: P04271