Recombinant Human S100PBP

Cat.No. : S100PBP-31371TH
Product Overview : Recombinant fragment, corresponding to amino acids 181-342 of Human S100P binding protein produced in Saccharomyces cerevisiae; 162 amino acids, MWt 17.9kDa, with a 25 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
Tissue specificity : Expressed in brain, spleen, and lung. Not detected in pancreas or liver. In pancreas, expressed predominantly in islet cells and to a lesser extent in acinar cells, but not expressed in ductal cells. Up-regulated in various pancreatic ductal adenocarcinom
Form : Liquid
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MREDGLSPNESKLCTESEGISPNNSAWNGPQLSSSNNNFQ QTVSDKNMPDSENPTSVFSRISDHSETPNMELSCRNGG SHKSSCEMRSLVVSTSSNKQDVLNKDSGKMKGHERRLG KVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDP EDTNQG
Gene Name : S100PBP S100P binding protein [ Homo sapiens ]
Official Symbol : S100PBP
Synonyms : S100PBP; S100P binding protein; S100P-binding protein; FLJ12903; S100P binding protein 1; S100PBPR;
Gene ID : 64766
mRNA Refseq : NM_022753
Protein Refseq : NP_073590
MIM : 611889
Uniprot ID : Q96BU1
Chromosome Location : 1p35.1
Function : calcium-dependent protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All S100PBP Products

Required fields are marked with *

My Review for All S100PBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

Stay Updated on the
Latest Bioscience Trends

Copyright © 2023 Creative BioMart. All Rights Reserved.

Terms and Conditions        Privacy Policy