Recombinant Human S100PBP
Cat.No. : | S100PBP-31371TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 181-342 of Human S100P binding protein produced in Saccharomyces cerevisiae; 162 amino acids, MWt 17.9kDa, with a 25 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Tissue specificity : | Expressed in brain, spleen, and lung. Not detected in pancreas or liver. In pancreas, expressed predominantly in islet cells and to a lesser extent in acinar cells, but not expressed in ductal cells. Up-regulated in various pancreatic ductal adenocarcinom |
Form : | Liquid |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MREDGLSPNESKLCTESEGISPNNSAWNGPQLSSSNNNFQ QTVSDKNMPDSENPTSVFSRISDHSETPNMELSCRNGG SHKSSCEMRSLVVSTSSNKQDVLNKDSGKMKGHERRLG KVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDP EDTNQG |
Tag : | Non |
Gene Name : | S100PBP S100P binding protein [ Homo sapiens ] |
Official Symbol : | S100PBP |
Synonyms : | S100PBP; S100P binding protein; S100P-binding protein; FLJ12903; S100P binding protein 1; S100PBPR; |
Gene ID : | 64766 |
mRNA Refseq : | NM_022753 |
Protein Refseq : | NP_073590 |
MIM : | 611889 |
Uniprot ID : | Q96BU1 |
Chromosome Location : | 1p35.1 |
Function : | calcium-dependent protein binding; |
Products Types
◆ Recombinant Protein | ||
S100PBP-7870M | Recombinant Mouse S100PBP Protein, His (Fc)-Avi-tagged | +Inquiry |
S100PBP-3883R | Recombinant Rhesus Macaque S100PBP Protein, His (Fc)-Avi-tagged | +Inquiry |
S100PBP-4066R | Recombinant Rhesus monkey S100PBP Protein, His-tagged | +Inquiry |
S100PBP-14626M | Recombinant Mouse S100PBP Protein | +Inquiry |
◆ Lysates | ||
S100PBP-1555HCL | Recombinant Human S100PBP cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Ask a Question for All S100PBP Products
Required fields are marked with *
My Review for All S100PBP Products
Required fields are marked with *
0
Inquiry Basket