Recombinant Human S100PBP
| Cat.No. : | S100PBP-31371TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 181-342 of Human S100P binding protein produced in Saccharomyces cerevisiae; 162 amino acids, MWt 17.9kDa, with a 25 kDa proprietary tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Tag : | Non | 
| Protein Length : | 181-342 a.a. | 
| Tissue specificity : | Expressed in brain, spleen, and lung. Not detected in pancreas or liver. In pancreas, expressed predominantly in islet cells and to a lesser extent in acinar cells, but not expressed in ductal cells. Up-regulated in various pancreatic ductal adenocarcinom | 
| Form : | Liquid | 
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MREDGLSPNESKLCTESEGISPNNSAWNGPQLSSSNNNFQ QTVSDKNMPDSENPTSVFSRISDHSETPNMELSCRNGG SHKSSCEMRSLVVSTSSNKQDVLNKDSGKMKGHERRLG KVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDP EDTNQG | 
| Gene Name | S100PBP S100P binding protein [ Homo sapiens ] | 
| Official Symbol | S100PBP | 
| Synonyms | S100PBP; S100P binding protein; S100P-binding protein; FLJ12903; S100P binding protein 1; S100PBPR; | 
| Gene ID | 64766 | 
| mRNA Refseq | NM_022753 | 
| Protein Refseq | NP_073590 | 
| MIM | 611889 | 
| Uniprot ID | Q96BU1 | 
| Chromosome Location | 1p35.1 | 
| Function | calcium-dependent protein binding; | 
| ◆ Recombinant Proteins | ||
| S100PBP-3883R | Recombinant Rhesus Macaque S100PBP Protein, His (Fc)-Avi-tagged | +Inquiry | 
| S100PBP-7870M | Recombinant Mouse S100PBP Protein, His (Fc)-Avi-tagged | +Inquiry | 
| S100PBP-4066R | Recombinant Rhesus monkey S100PBP Protein, His-tagged | +Inquiry | 
| S100PBP-14626M | Recombinant Mouse S100PBP Protein | +Inquiry | 
| S100PBP-31371TH | Recombinant Human S100PBP | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| S100PBP-1555HCL | Recombinant Human S100PBP cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100PBP Products
Required fields are marked with *
My Review for All S100PBP Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            