Recombinant Human S100Z Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100Z-4683H
Product Overview : S100Z MS Standard C13 and N15-labeled recombinant protein (NP_570128) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins.
Molecular Mass : 11.6 kDa
AA Sequence : MPTQLEMAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100Z S100 calcium binding protein Z [ Homo sapiens (human) ]
Official Symbol S100Z
Synonyms S100Z; S100 calcium binding protein Z; S100 calcium binding protein, zeta; protein S100-Z; Gm625; S100 zeta; S100 calcium-binding protein Z; S100-zeta;
Gene ID 170591
mRNA Refseq NM_130772
Protein Refseq NP_570128
MIM 610103
UniProt ID Q8WXG8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100Z Products

Required fields are marked with *

My Review for All S100Z Products

Required fields are marked with *

0
cart-icon