Recombinant Human S100Z Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100Z-4683H |
Product Overview : | S100Z MS Standard C13 and N15-labeled recombinant protein (NP_570128) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins. |
Molecular Mass : | 11.6 kDa |
AA Sequence : | MPTQLEMAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100Z S100 calcium binding protein Z [ Homo sapiens (human) ] |
Official Symbol | S100Z |
Synonyms | S100Z; S100 calcium binding protein Z; S100 calcium binding protein, zeta; protein S100-Z; Gm625; S100 zeta; S100 calcium-binding protein Z; S100-zeta; |
Gene ID | 170591 |
mRNA Refseq | NM_130772 |
Protein Refseq | NP_570128 |
MIM | 610103 |
UniProt ID | Q8WXG8 |
◆ Recombinant Proteins | ||
S100z-2040M | Recombinant Mouse S100z Protein, His&GST-tagged | +Inquiry |
S100Z-206H | Recombinant HumanS100 calcium binding protein Z | +Inquiry |
S100Z-2998Z | Recombinant Zebrafish S100Z | +Inquiry |
S100Z-5668C | Recombinant Chicken S100Z | +Inquiry |
S100Z-2581H | Recombinant Human S100 Calcium Binding Protein Z, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100Z-2085HCL | Recombinant Human S100Z 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100Z Products
Required fields are marked with *
My Review for All S100Z Products
Required fields are marked with *