Recombinant Human SAAL1 protein, GST-tagged
Cat.No. : | SAAL1-301101H |
Product Overview : | Recombinant Human SAAL1 (181-475 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His181-Thr475 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HPAIYDSICFIMSSSTNVDLLVKVGEVVDKLFDLDEKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWLDVYMHILQLLTTVDDGIQAIVHCPDTGKDIWNLLFDLVCHEFCQSDDPPIILQEQKTVLASVFSVLSAIYASQTEQEYLKIEKVDLPLIDSLIRVLQNMEQCQKKPENSAESNTEETKRTDLTQDDFHLKILKDILCEFLSNIFQALTKETVAQGVKEGQLSKQKCSSAFQNLLPFYSPVVEDFIKILREVDKALADDLEKNFPSLKVQT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SAAL1 serum amyloid A-like 1 [ Homo sapiens ] |
Official Symbol | SAAL1 |
Synonyms | SAAL1; serum amyloid A-like 1; protein SAAL1; FLJ41463; synoviocyte proliferation-associated in collagen-induced arthritis 1; SPACIA1; |
Gene ID | 113174 |
mRNA Refseq | NM_138421 |
Protein Refseq | NP_612430 |
UniProt ID | Q96ER3 |
◆ Recombinant Proteins | ||
Saal1-4791M | Recombinant Mouse Saal1 protein, His&Myc-tagged | +Inquiry |
SAAL1-301101H | Recombinant Human SAAL1 protein, GST-tagged | +Inquiry |
SAAL1-10486Z | Recombinant Zebrafish SAAL1 | +Inquiry |
Saal1-5675M | Recombinant Mouse Saal1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAAL1-2077HCL | Recombinant Human SAAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAAL1 Products
Required fields are marked with *
My Review for All SAAL1 Products
Required fields are marked with *
0
Inquiry Basket