| Species : | Human | 
                                
                                    | Source : | Wheat Germ | 
                                
                                    | Tag : | Non | 
                                
                                    | Protein Length : | 90 amino acids | 
                                
                                    | Description : | This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a transcriptosome complex in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene. | 
                                
                                    | Molecular Weight : | 35.530kDa inclusive of tags | 
                                
                                    | Tissue specificity : | Ubiquitous. Expressed at high levels in the CNS and at low levels in the liver. Expressed in a wide number of breast cancer cell lines. | 
                                
                                    | Form : | Liquid | 
                                
                                    | Purity : | Proprietary Purification | 
                                
                                    | Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
                                
                                    | Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
                                
                                    | Sequences of amino acids : | DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT | 
                                
                                    | Sequence Similarities : | Contains 1 RRM (RNA recognition motif) domain.Contains 1 SAP domain. |