Recombinant Human SAFB protein, His-tagged

• Cat.No.: SAFB-2597H
• Product Overview: Recombinant Human SAFB protein(58-213 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 58-213 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SAFB scaffold attachment factor B [ Homo sapiens ]
• Official Symbol: SAFB
• Synonyms: SAFB; scaffold attachment factor B; scaffold attachment factor B1; HET; Hsp27 ERE TATA binding protein; SAFB1; SAF-B; SAB-B1; HSP27 ERE-TATA-binding protein; Hsp27 ERE-TATA binding protein; glutathione S-transferase fusion protein; HSP27 estrogen response element-TATA box-binding protein; heat-shock protein (HSP27) estrogen response element and TATA box-binding protein; HAP; SAF-B1; DKFZp779C1727
• Gene ID: 6294
• mRNA Refseq: NM_001201338
• Protein Refseq: NP_001188267
• MIM: 602895
• UniProt ID: Q15424

Q&As

What is the molecular weight of SAFB-2597H? Thanks for your help.

Thank you for your interest in our product. The MW of SAFB-2597H is 35KDa.