Recombinant Human SAFB protein, His-tagged

Cat.No. : SAFB-2597H
Product Overview : Recombinant Human SAFB protein(58-213 aa), fused to His tag, was expressed in E. coli.
Availability November 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 58-213 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SAFB scaffold attachment factor B [ Homo sapiens ]
Official Symbol SAFB
Synonyms SAFB; scaffold attachment factor B; scaffold attachment factor B1; HET; Hsp27 ERE TATA binding protein; SAFB1; SAF-B; SAB-B1; HSP27 ERE-TATA-binding protein; Hsp27 ERE-TATA binding protein; glutathione S-transferase fusion protein; HSP27 estrogen response element-TATA box-binding protein; heat-shock protein (HSP27) estrogen response element and TATA box-binding protein; HAP; SAF-B1; DKFZp779C1727;
Gene ID 6294
mRNA Refseq NM_001201338
Protein Refseq NP_001188267
MIM 602895
UniProt ID Q15424

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

What is the molecular weight of SAFB-2597H? Thanks for your help. SAFB-2597H 10/02/2024

Thank you for your interest in our product. The MW of SAFB-2597H is 35KDa.

Ask a Question for All SAFB Products

Required fields are marked with *

My Review for All SAFB Products

Required fields are marked with *

0
cart-icon
0
compare icon