Recombinant Human SAFB protein, His-tagged
Cat.No. : | SAFB-2597H |
Product Overview : | Recombinant Human SAFB protein(58-213 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 58-213 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SAFB scaffold attachment factor B [ Homo sapiens ] |
Official Symbol | SAFB |
Synonyms | SAFB; scaffold attachment factor B; scaffold attachment factor B1; HET; Hsp27 ERE TATA binding protein; SAFB1; SAF-B; SAB-B1; HSP27 ERE-TATA-binding protein; Hsp27 ERE-TATA binding protein; glutathione S-transferase fusion protein; HSP27 estrogen response element-TATA box-binding protein; heat-shock protein (HSP27) estrogen response element and TATA box-binding protein; HAP; SAF-B1; DKFZp779C1727; |
Gene ID | 6294 |
mRNA Refseq | NM_001201338 |
Protein Refseq | NP_001188267 |
MIM | 602895 |
UniProt ID | Q15424 |
◆ Recombinant Proteins | ||
SAFB-7884M | Recombinant Mouse SAFB Protein, His (Fc)-Avi-tagged | +Inquiry |
SAFB-2500H | Recombinant Human SAFB, GST-tagged | +Inquiry |
Safb-2042M | Recombinant Mouse Safb Protein, His&GST-tagged | +Inquiry |
SAFB-29263TH | Recombinant Human SAFB | +Inquiry |
SAFB-5224R | Recombinant Rat SAFB Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All SAFB Products
Required fields are marked with *
My Review for All SAFB Products
Required fields are marked with *