Recombinant Human SAMD12 protein, GST-tagged
Cat.No. : | SAMD12-7866H |
Product Overview : | Recombinant Human SAMD12 protein(1-77 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-77 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAVEALHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKLSKPVALW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SAMD12 sterile alpha motif domain containing 12 [ Homo sapiens ] |
Official Symbol | SAMD12 |
Gene ID | 401474 |
mRNA Refseq | NM_207506.2 |
Protein Refseq | NP_997389.2 |
UniProt ID | Q8N8I0 |
◆ Recombinant Proteins | ||
SAMD12-7866H | Recombinant Human SAMD12 protein, GST-tagged | +Inquiry |
SAMD12-14650M | Recombinant Mouse SAMD12 Protein | +Inquiry |
SAMD12-7865H | Recombinant Human SAMD12 protein, His-tagged | +Inquiry |
SAMD12-282H | Recombinant Human SAMD12 Protein, His-tagged | +Inquiry |
SAMD12-7889M | Recombinant Mouse SAMD12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAMD12-2073HCL | Recombinant Human SAMD12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAMD12 Products
Required fields are marked with *
My Review for All SAMD12 Products
Required fields are marked with *