Recombinant Human SAP30BP Protein, GST-tagged

• Cat.No.: SAP30BP-4631H
• Product Overview: Human HCNGP full-length ORF ( AAH07592, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SAP30BP (SAP30 Binding Protein) is a Protein Coding gene. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Gene Expression.
• Molecular Mass: 59.62 kDa
• AA Sequence: MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SAP30BP SAP30 binding protein [ Homo sapiens (human) ]
• Official Symbol: SAP30BP
• Synonyms: SAP30BP; SAP30 binding protein; HTRG; HTRP; HCNGP; SAP30-binding protein; HSV-1 binding; transcriptional regulator protein HCNGP
• Gene ID: 29115
• mRNA Refseq: NM_001301839
• Protein Refseq: NP_001288768
• MIM: 610218
• UniProt ID: Q9UHR5