| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Human saposin C is small, heat-stable glycoprotein activator of lysosomal glycosphingolipid hydrolases that derive from a single precursor, prosaposin, by proteolytic cleavage. Of the prosaposin derived saposins, saposin C shows the highest amino acid identity/similarity to saposin A. Saposin C is an essential activator for glucocerebrosidase, the enzyme deficient in Gaucher disease. It plays role in antigen presentation of lipids through CD1b to human T cells. Saposins are glycosylated in a native state; however, non-glycosylated recombinant saposins produced in E. coli retain their respective activation effects in functional in vitro assays. |
| AA Sequence : |
MSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGGGHHHHHH |
| Purity : |
> 90% by Coomassie staining |
| Notes : |
This product is for laboratory research use only. |
| Storage : |
Storage is recommended at -20 centigrade for longer periods of time. |
| Concentration : |
1.0 mg/mL by A280 |
| Storage Buffer : |
10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 50% Glycerol. |
| Shipping : |
Product requires shipping on ice packs. |
