Recombinant Human SARM1 protein(409-702aa), His-KSI-tagged
| Cat.No. : | SARM1-6434H |
| Product Overview : | Recombinant Human SARM1 protein(Q6SZW1)(409-702aa), fused with N-terminal His and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 409-702aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | VPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR |
| Gene Name | SARM1 sterile alpha and TIR motif containing 1 [ Homo sapiens ] |
| Official Symbol | SARM1 |
| Synonyms | SARM1; sterile alpha and TIR motif containing 1; sterile alpha and TIR motif-containing protein 1; KIAA0524; SAMD2; SARM; tir-1 homolog; SAM domain-containing protein 2; sterile alpha and Armadillo repeat protein; sterile alpha motif domain-containing protein 2; sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila; FLJ36296; |
| Gene ID | 23098 |
| mRNA Refseq | NM_015077 |
| Protein Refseq | NP_055892 |
| MIM | 607732 |
| UniProt ID | Q6SZW1 |
| ◆ Recombinant Proteins | ||
| SARM1-3199H | Recombinant Human SARM1 protein, His-tagged | +Inquiry |
| SARM1-1954H | Recombinant Human SARM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SARM1-4076R | Recombinant Rhesus monkey SARM1 Protein, His-tagged | +Inquiry |
| Sarm1-5690M | Recombinant Mouse Sarm1 Protein, Myc/DDK-tagged | +Inquiry |
| SARM1-5632H | Recombinant Human SARM1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SARM1 Products
Required fields are marked with *
My Review for All SARM1 Products
Required fields are marked with *



