Recombinant Human SARNP, His-tagged

• Cat.No.: SARNP-27193TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-210 of Human CIP29 with N terminal His tag, Predicted MWt 25 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-210 a.a.
• Description: This gene encodes a protein that is upregulated in response to various cytokines. The encoded protein may play a role in cell cycle progression. A translocation between this gene and the myeloid/lymphoid leukemia gene, resulting in expression of a chimeric protein, has been associated with acute myelomonocytic leukemia. Pseudogenes exist on chromosomes 7 and 8. Alternatively spliced transcript variants have been described.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 112 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQA YLEEHAEEEANEEDVLGDETEEEETKPIELPVKEEEPP EKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSL ESKKAARAARFGISSVPTKGLSSDNKPMVNLDKLKERA QRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTE DTEAKKRKRAERFGIA
• Full Length: Full L.

Gene Information

• Gene Name: SARNP SAP domain containing ribonucleoprotein [ Homo sapiens ]
• Official Symbol: SARNP
• Synonyms: SARNP; SAP domain containing ribonucleoprotein; SAP domain-containing ribonucleoprotein; CIP29; cytokine induced protein 29 kDa; Hcc 1; hepatocellular carcinoma 1; THO1
• Gene ID: 84324
• mRNA Refseq: NM_033082
• Protein Refseq: NP_149073
• MIM: 610049
• Uniprot ID: P82979
• Chromosome Location: 12q13.2
• Function: DNA binding; RNA binding; RS domain binding; nucleic acid binding; protein C-terminus binding