Recombinant Human SARNP, His-tagged
Cat.No. : | SARNP-27193TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-210 of Human CIP29 with N terminal His tag, Predicted MWt 25 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-210 a.a. |
Description : | This gene encodes a protein that is upregulated in response to various cytokines. The encoded protein may play a role in cell cycle progression. A translocation between this gene and the myeloid/lymphoid leukemia gene, resulting in expression of a chimeric protein, has been associated with acute myelomonocytic leukemia. Pseudogenes exist on chromosomes 7 and 8. Alternatively spliced transcript variants have been described. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 112 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQA YLEEHAEEEANEEDVLGDETEEEETKPIELPVKEEEPP EKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSL ESKKAARAARFGISSVPTKGLSSDNKPMVNLDKLKERA QRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTE DTEAKKRKRAERFGIA |
Full Length : | Full L. |
Gene Name | SARNP SAP domain containing ribonucleoprotein [ Homo sapiens ] |
Official Symbol | SARNP |
Synonyms | SARNP; SAP domain containing ribonucleoprotein; SAP domain-containing ribonucleoprotein; CIP29; cytokine induced protein 29 kDa; Hcc 1; hepatocellular carcinoma 1; THO1; |
Gene ID | 84324 |
mRNA Refseq | NM_033082 |
Protein Refseq | NP_149073 |
MIM | 610049 |
Uniprot ID | P82979 |
Chromosome Location | 12q13.2 |
Function | DNA binding; RNA binding; RS domain binding; nucleic acid binding; protein C-terminus binding; |
◆ Recombinant Proteins | ||
SARNP-1370H | Recombinant Human SARNP Protein, GST-tagged | +Inquiry |
SARNP-4889R | Recombinant Rat SARNP Protein, His (Fc)-Avi-tagged | +Inquiry |
SARNP-3011Z | Recombinant Zebrafish SARNP | +Inquiry |
SARNP-2978C | Recombinant Chicken SARNP | +Inquiry |
SARNP-27193TH | Recombinant Human SARNP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SARNP-2062HCL | Recombinant Human SARNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SARNP Products
Required fields are marked with *
My Review for All SARNP Products
Required fields are marked with *
0
Inquiry Basket