Recombinant Human SAT1 protein, His-tagged
| Cat.No. : | SAT1-3472H |
| Product Overview : | Recombinant Human SAT1 protein(P21673)(5-171aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 5-171aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.5 kDa |
| AA Sequence : | VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SAT1 spermidine/spermine N1-acetyltransferase 1 [ Homo sapiens ] |
| Official Symbol | SAT1 |
| Synonyms | SAT1; spermidine/spermine N1-acetyltransferase 1; SAT, spermidine/spermine N1 acetyltransferase; diamine acetyltransferase 1; diamine N acetyltransferase 1; SSAT; putrescine acetyltransferase; diamine N-acetyltransferase 1; polyamine N-acetyltransferase 1; spermidine/spermine N(1)-acetyltransferase 1; spermidine/spermine N1-acetyltransferase alpha; SAT; DC21; KFSD; KFSDX; SSAT-1; |
| Gene ID | 6303 |
| mRNA Refseq | NM_002970 |
| Protein Refseq | NP_002961 |
| MIM | 313020 |
| UniProt ID | P21673 |
| ◆ Recombinant Proteins | ||
| SAT1-189H | Recombinant Human SAT1, His-tagged | +Inquiry |
| SAT1-3472H | Recombinant Human SAT1 protein, His-tagged | +Inquiry |
| SAT1-4079R | Recombinant Rhesus monkey SAT1 Protein, His-tagged | +Inquiry |
| SAT1-5760C | Recombinant Chicken SAT1 | +Inquiry |
| Sat1-573R | Recombinant Rat Sat1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SAT1-2056HCL | Recombinant Human SAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAT1 Products
Required fields are marked with *
My Review for All SAT1 Products
Required fields are marked with *
