Recombinant Human SAYSD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SAYSD1-5094H
• Product Overview: C6orf64 MS Standard C13 and N15-labeled recombinant protein (NP_060792) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SAYSD1 (SAYSVFN Motif Domain Containing 1) is a Protein Coding gene.
• Molecular Mass: 20.2 kDa
• AA Sequence: MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPASARAQPGLVQEAAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELEFGLAYFVLSLFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SAYSD1 SAYSVFN motif domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: SAYSD1
• Synonyms: SAYSD1; SAYSVFN motif domain containing 1; C6orf64; SAYSvFN domain-containing protein 1
• Gene ID: 55776
• mRNA Refseq: NM_018322
• Protein Refseq: NP_060792
• UniProt ID: Q9NPB0