Recombinant Human SBK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SBK1-5285H
• Product Overview: SBK1 MS Standard C13 and N15-labeled recombinant protein (NP_001019572) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SBK1 (SH3 Domain Binding Kinase 1) is a Protein Coding gene. Diseases associated with SBK1 include Punctate Epithelial Keratoconjunctivitis and Corneal Ectasia. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is SBK3.
• Molecular Mass: 46.1 kDa
• AA Sequence: MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGPLKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAIEICVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SBK1 SH3-binding domain kinase 1 [ Homo sapiens (human) ]
• Official Symbol: SBK1
• Synonyms: SBK1; SH3-binding domain kinase 1; serine/threonine-protein kinase SBK1; Sbk; SH3-binding kinase 1
• Gene ID: 388228
• mRNA Refseq: NM_001024401
• Protein Refseq: NP_001019572
• UniProt ID: Q52WX2