Recombinant Human SBK1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SBK1-5285H |
Product Overview : | SBK1 MS Standard C13 and N15-labeled recombinant protein (NP_001019572) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SBK1 (SH3 Domain Binding Kinase 1) is a Protein Coding gene. Diseases associated with SBK1 include Punctate Epithelial Keratoconjunctivitis and Corneal Ectasia. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is SBK3. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGPLKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAIEICVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SBK1 SH3-binding domain kinase 1 [ Homo sapiens (human) ] |
Official Symbol | SBK1 |
Synonyms | SBK1; SH3-binding domain kinase 1; serine/threonine-protein kinase SBK1; Sbk; SH3-binding kinase 1; |
Gene ID | 388228 |
mRNA Refseq | NM_001024401 |
Protein Refseq | NP_001019572 |
UniProt ID | Q52WX2 |
◆ Recombinant Proteins | ||
SBK1-14693M | Recombinant Mouse SBK1 Protein | +Inquiry |
SBK1-7913M | Recombinant Mouse SBK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sbk1-253M | Recombinant Mouse Sbk1 Protein, MYC/DDK-tagged | +Inquiry |
SBK1-4894R | Recombinant Rat SBK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SBK1-5285H | Recombinant Human SBK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SBK1 Products
Required fields are marked with *
My Review for All SBK1 Products
Required fields are marked with *
0
Inquiry Basket