Recombinant Human SCARB2 protein(71-180 aa), C-His-tagged

Cat.No. : SCARB2-2867H
Product Overview : Recombinant Human SCARB2 protein(Q14108)(71-180 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 71-180 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY
Gene Name SCARB2 scavenger receptor class B, member 2 [ Homo sapiens ]
Official Symbol SCARB2
Synonyms SCARB2; scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor) like 2 (lysosomal integral membrane protein II) , CD36L2; lysosome membrane protein 2; HLGP85; LIMP 2; LIMPII; SR BII; LIMP II; CD36 antigen-like 2; lysosome membrane protein II; 85 kDa lysosomal membrane sialoglycoprotein; 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II); AMRF; EPM4; LGP85; CD36L2; LIMP-2; SR-BII;
Gene ID 950
mRNA Refseq NM_001204255
Protein Refseq NP_001191184
MIM 602257
UniProt ID Q14108

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCARB2 Products

Required fields are marked with *

My Review for All SCARB2 Products

Required fields are marked with *

0
cart-icon