Recombinant Human SCARB2 protein, GST-tagged
| Cat.No. : | SCARB2-4576H |
| Product Overview : | Recombinant Human SCARB2 protein(249-433 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 249-433 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | NGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTL |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SCARB2 scavenger receptor class B, member 2 [ Homo sapiens ] |
| Official Symbol | SCARB2 |
| Synonyms | SCARB2; scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor) like 2 (lysosomal integral membrane protein II) , CD36L2; lysosome membrane protein 2; HLGP85; LIMP 2; LIMPII; SR BII; LIMP II; CD36 antigen-like 2; lysosome membrane protein II; 85 kDa lysosomal membrane sialoglycoprotein; 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II); AMRF; EPM4; LGP85; CD36L2; LIMP-2; SR-BII; |
| Gene ID | 950 |
| mRNA Refseq | NM_001204255 |
| Protein Refseq | NP_001191184 |
| MIM | 602257 |
| UniProt ID | Q14108 |
| ◆ Recombinant Proteins | ||
| SCARB2-1959H | Recombinant Human SCARB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCARB2-4576H | Recombinant Human SCARB2 protein, GST-tagged | +Inquiry |
| Scarb2-3999M | Recombinant Mouse Scarb2 protein, His-tagged | +Inquiry |
| SCARB2-2188H | Active Recombinant Human SCARB2 protein, His&hFc-tagged | +Inquiry |
| SCARB2-5244R | Recombinant Rat SCARB2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCARB2-2752HCL | Recombinant Human SCARB2 cell lysate | +Inquiry |
| SCARB2-2413MCL | Recombinant Mouse SCARB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCARB2 Products
Required fields are marked with *
My Review for All SCARB2 Products
Required fields are marked with *
