Recombinant Human SCARB2 protein, GST-tagged

Cat.No. : SCARB2-4576H
Product Overview : Recombinant Human SCARB2 protein(249-433 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 249-433 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : NGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTL
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name SCARB2 scavenger receptor class B, member 2 [ Homo sapiens ]
Official Symbol SCARB2
Synonyms SCARB2; scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor) like 2 (lysosomal integral membrane protein II) , CD36L2; lysosome membrane protein 2; HLGP85; LIMP 2; LIMPII; SR BII; LIMP II; CD36 antigen-like 2; lysosome membrane protein II; 85 kDa lysosomal membrane sialoglycoprotein; 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II); AMRF; EPM4; LGP85; CD36L2; LIMP-2; SR-BII;
Gene ID 950
mRNA Refseq NM_001204255
Protein Refseq NP_001191184
MIM 602257
UniProt ID Q14108

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCARB2 Products

Required fields are marked with *

My Review for All SCARB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon