Recombinant Human SCARB2 protein, His-tagged

• Cat.No.: SCARB2-4577H
• Product Overview: Recombinant Human SCARB2 protein(249-433 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 249-433 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: NGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SCARB2 scavenger receptor class B, member 2 [ Homo sapiens ]
• Official Symbol: SCARB2
• Synonyms: SCARB2; scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor) like 2 (lysosomal integral membrane protein II) , CD36L2; lysosome membrane protein 2; HLGP85; LIMP 2; LIMPII; SR BII; LIMP II; CD36 antigen-like 2; lysosome membrane protein II; 85 kDa lysosomal membrane sialoglycoprotein; 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II); AMRF; EPM4; LGP85; CD36L2; LIMP-2; SR-BII
• Gene ID: 950
• mRNA Refseq: NM_001204255
• Protein Refseq: NP_001191184
• MIM: 602257
• UniProt ID: Q14108