Recombinant Human SCARB2 protein, His-tagged
Cat.No. : | SCARB2-4577H |
Product Overview : | Recombinant Human SCARB2 protein(249-433 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 249-433 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | NGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SCARB2 scavenger receptor class B, member 2 [ Homo sapiens ] |
Official Symbol | SCARB2 |
Synonyms | SCARB2; scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor) like 2 (lysosomal integral membrane protein II) , CD36L2; lysosome membrane protein 2; HLGP85; LIMP 2; LIMPII; SR BII; LIMP II; CD36 antigen-like 2; lysosome membrane protein II; 85 kDa lysosomal membrane sialoglycoprotein; 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2; CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II); AMRF; EPM4; LGP85; CD36L2; LIMP-2; SR-BII; |
Gene ID | 950 |
mRNA Refseq | NM_001204255 |
Protein Refseq | NP_001191184 |
MIM | 602257 |
UniProt ID | Q14108 |
◆ Recombinant Proteins | ||
SCARB2-850H | Recombinant Human SCARB2, Fc-His tagged | +Inquiry |
SCARB2-6629H | Recombinant Human SCARB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL4155RF | Recombinant Full Length Rat Lysosome Membrane Protein 2(Scarb2) Protein, His-Tagged | +Inquiry |
Scarb2-851M | Recombinant Mouse scavenger receptor class B, member 2, His-tagged | +Inquiry |
SCARB2-470H | Recombinant Human SCARB2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCARB2-2752HCL | Recombinant Human SCARB2 cell lysate | +Inquiry |
SCARB2-2413MCL | Recombinant Mouse SCARB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCARB2 Products
Required fields are marked with *
My Review for All SCARB2 Products
Required fields are marked with *