Recombinant Human SCART1 Protein, GST-tagged

• Cat.No.: SCART1-4766H
• Product Overview: Human LOC619207 full-length ORF ( AAH38300.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SCART1 (Scavenger Receptor Family Member Expressed On T-Cells 1) is a Pseudogene. GO annotations related to this gene include scavenger receptor activity. An important paralog of this gene is CD163.
• Molecular Mass: 51.5 kDa
• AA Sequence: MRAALWTLGLGPLLLNLWAVPIGGPGALRLAYRHSTCDGVVLVRHHGAWGYVCNQEWTLAEASVVCRQLGCGPAVGAPKYVPLPGEMAKPWLHNVSCRGNESSLWECSLGSWCQSPCPHAWVVVALCSNGTFRELGLVKGRSPCAGLPEIRNVNGVDRLCVLHVEEAMVFCRELGCGPVLQAPRRDVGVVRKYLACRGTEPTIRSCRLDNNFRSGCDLRLDAEVVCSGEAAT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SCART1 scavenger receptor family member expressed on T-cells 1 [ Homo sapiens (human) ]
• Official Symbol: SCART1
• Synonyms: SCART1; scavenger receptor family member expressed on T-cells 1; CD163c-alpha; scavenger receptor protein family member
• Gene ID: 619207