Recombinant Full Length Human SCART1 Protein, GST-tagged

Cat.No. : SCART1-5911HF
Product Overview : Human LOC619207 full-length ORF ( AAH38300.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 232 amino acids
Description : SCART1 (Scavenger Receptor Family Member Expressed On T-Cells 1) is a Pseudogene. GO annotations related to this gene include scavenger receptor activity. An important paralog of this gene is CD163.
Molecular Mass : 51.5 kDa
AA Sequence : MRAALWTLGLGPLLLNLWAVPIGGPGALRLAYRHSTCDGVVLVRHHGAWGYVCNQEWTLAEASVVCRQLGCGPAVGAPKYVPLPGEMAKPWLHNVSCRGNESSLWECSLGSWCQSPCPHAWVVVALCSNGTFRELGLVKGRSPCAGLPEIRNVNGVDRLCVLHVEEAMVFCRELGCGPVLQAPRRDVGVVRKYLACRGTEPTIRSCRLDNNFRSGCDLRLDAEVVCSGEAAT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SCART1 scavenger receptor family member expressed on T-cells 1 [ Homo sapiens (human) ]
Official Symbol SCART1
Synonyms SCART1; scavenger receptor family member expressed on T-cells 1; CD163c-alpha; scavenger receptor protein family member
Gene ID 619207

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCART1 Products

Required fields are marked with *

My Review for All SCART1 Products

Required fields are marked with *

0
cart-icon
0
compare icon