Recombinant Full Length Human SCART1 Protein, GST-tagged
Cat.No. : | SCART1-5911HF |
Product Overview : | Human LOC619207 full-length ORF ( AAH38300.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 232 amino acids |
Description : | SCART1 (Scavenger Receptor Family Member Expressed On T-Cells 1) is a Pseudogene. GO annotations related to this gene include scavenger receptor activity. An important paralog of this gene is CD163. |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MRAALWTLGLGPLLLNLWAVPIGGPGALRLAYRHSTCDGVVLVRHHGAWGYVCNQEWTLAEASVVCRQLGCGPAVGAPKYVPLPGEMAKPWLHNVSCRGNESSLWECSLGSWCQSPCPHAWVVVALCSNGTFRELGLVKGRSPCAGLPEIRNVNGVDRLCVLHVEEAMVFCRELGCGPVLQAPRRDVGVVRKYLACRGTEPTIRSCRLDNNFRSGCDLRLDAEVVCSGEAAT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SCART1 scavenger receptor family member expressed on T-cells 1 [ Homo sapiens (human) ] |
Official Symbol | SCART1 |
Synonyms | SCART1; scavenger receptor family member expressed on T-cells 1; CD163c-alpha; scavenger receptor protein family member |
Gene ID | 619207 |
◆ Recombinant Proteins | ||
SCART1-4766H | Recombinant Human SCART1 Protein, GST-tagged | +Inquiry |
SCART1-5911HF | Recombinant Full Length Human SCART1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCART1-1020HCL | Recombinant Human SCART1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCART1 Products
Required fields are marked with *
My Review for All SCART1 Products
Required fields are marked with *