Recombinant Human SCFV Protein

• Cat.No.: SCFV-72H
• Product Overview: Recombinant Human SCFV Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: single-chain Fv fragment
• Form: Liquid. In 50mM NaH2PO4, 300mM NaCl, 10% glycerol, pH 8.0.
• Molecular Mass: ~25.8 kDa
• AA Sequence: EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIK
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 1.3 mg/ml

Gene Information

• Gene Name: SCFV single-chain Fv fragment [ Homo sapiens (human) ]
• Official Symbol: SCFV
• Gene ID: 652070
• UniProt ID: A2KBC2