Recombinant Human SCG2 protein(261-380 aa), C-His-tagged
Cat.No. : | SCG2-2648H |
Product Overview : | Recombinant Human SCG2 protein(P13521)(261-380 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 261-380 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIEISRNLQIPPEDLIEMLKTGEKPNGSVE |
Gene Name | SCG2 secretogranin II [ Homo sapiens ] |
Official Symbol | SCG2 |
Synonyms | SCG2; secretogranin II; secretogranin-2; CHGC; chromogranin C; secretoneurin; SgII; SN; chromogranin-C; EM66; |
Gene ID | 7857 |
mRNA Refseq | NM_003469 |
Protein Refseq | NP_003460 |
MIM | 118930 |
UniProt ID | P13521 |
◆ Recombinant Proteins | ||
SCG2-2648H | Recombinant Human SCG2 protein(261-380 aa), C-His-tagged | +Inquiry |
SCG2-5249R | Recombinant Rat SCG2 Protein | +Inquiry |
SCG2-225H | Recombinant Human SCG2 protein, His-tagged | +Inquiry |
SCG2-6587H | Recombinant Human SCG2 Protein (Ser29-Met617), C-His tagged | +Inquiry |
SCG2-4090R | Recombinant Rhesus monkey SCG2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCG2 Products
Required fields are marked with *
My Review for All SCG2 Products
Required fields are marked with *
0
Inquiry Basket