Recombinant Human SCG2 protein(261-380 aa), C-His-tagged
| Cat.No. : | SCG2-2648H |
| Product Overview : | Recombinant Human SCG2 protein(P13521)(261-380 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 261-380 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | TQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIEISRNLQIPPEDLIEMLKTGEKPNGSVE |
| Gene Name | SCG2 secretogranin II [ Homo sapiens ] |
| Official Symbol | SCG2 |
| Synonyms | SCG2; secretogranin II; secretogranin-2; CHGC; chromogranin C; secretoneurin; SgII; SN; chromogranin-C; EM66; |
| Gene ID | 7857 |
| mRNA Refseq | NM_003469 |
| Protein Refseq | NP_003460 |
| MIM | 118930 |
| UniProt ID | P13521 |
| ◆ Recombinant Proteins | ||
| SCG2-007H | Recombinant Human SCG2 Protein, MET1-Met617, C-His tagged | +Inquiry |
| SCG2-1960H | Recombinant Human SCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Scg2-353M | Recombinant Mouse Scg2 Protein, His/GST-tagged | +Inquiry |
| SCG2-4090R | Recombinant Rhesus monkey SCG2 Protein, His-tagged | +Inquiry |
| SCG2-2480H | Recombinant Human SCG2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCG2 Products
Required fields are marked with *
My Review for All SCG2 Products
Required fields are marked with *




