Recombinant Human SCG2 protein, His-tagged
| Cat.No. : | SCG2-2480H |
| Product Overview : | Recombinant Human SCG2 protein(418-617 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 418-617 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TPGGAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEGDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SCG2 secretogranin II [ Homo sapiens ] |
| Official Symbol | SCG2 |
| Synonyms | SCG2; secretogranin II; secretogranin-2; CHGC; chromogranin C; secretoneurin; SgII; SN; chromogranin-C; EM66; |
| Gene ID | 7857 |
| mRNA Refseq | NM_003469 |
| Protein Refseq | NP_003460 |
| MIM | 118930 |
| UniProt ID | P13521 |
| ◆ Recombinant Proteins | ||
| Scg2-353M | Recombinant Mouse Scg2 Protein, His/GST-tagged | +Inquiry |
| SCG2-350H | Recombinant Human SCG2 Protein, His-tagged | +Inquiry |
| SCG2-4090R | Recombinant Rhesus monkey SCG2 Protein, His-tagged | +Inquiry |
| Scg2-5707M | Recombinant Mouse Scg2 Protein, Myc/DDK-tagged | +Inquiry |
| SCG2-485HFL | Active Recombinant Full Length Human SCG2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCG2 Products
Required fields are marked with *
My Review for All SCG2 Products
Required fields are marked with *
