Recombinant Human SCG3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SCG3-6609H |
Product Overview : | SCG3 MS Standard C13 and N15-labeled recombinant protein (NP_037375) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 53 kDa |
AA Sequence : | MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAAFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SCG3 secretogranin III [ Homo sapiens (human) ] |
Official Symbol | SCG3 |
Synonyms | SCG3; secretogranin III; secretogranin-3; FLJ90833; SGIII; |
Gene ID | 29106 |
mRNA Refseq | NM_013243 |
Protein Refseq | NP_037375 |
MIM | 611796 |
UniProt ID | Q8WXD2 |
◆ Recombinant Proteins | ||
SCG3-2526H | Recombinant Full Length Human SCG3, GST-tagged | +Inquiry |
SCG3-14729M | Recombinant Full Length Mouse Scg3 Protein, His-tagged | +Inquiry |
SCG3-465H | Recombinant Human SCG3 Protein, MYC/DDK-tagged | +Inquiry |
SCG3-5566C | Recombinant Chicken SCG3 | +Inquiry |
SCG3-1441C | Recombinant Cynomolgus SCG3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCG3-775HCL | Recombinant Human SCG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCG3 Products
Required fields are marked with *
My Review for All SCG3 Products
Required fields are marked with *
0
Inquiry Basket