Recombinant Human SCG5 protein(101-170 aa), N-mSUMO & C-His-tagged
Cat.No. : | SCG5-2561H |
Product Overview : | Recombinant Human SCG5 protein(P05408)(101-170 aa), fused with N-terminal mSUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 101-170 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYE |
Gene Name | SCG5 secretogranin V (7B2 protein) [ Homo sapiens ] |
Official Symbol | SCG5 |
Synonyms | SCG5; secretogranin V (7B2 protein); secretory granule, neuroendocrine protein 1 (7B2 protein) , SGNE1; neuroendocrine protein 7B2; 7B2; prohormone convertase chaperone; SgV; secretogranin-5; pituitary polypeptide; secretory granule endocrine protein I; secretory granule, neuroendocrine protein 1 (7B2 protein); P7B2; SGNE1; |
Gene ID | 6447 |
mRNA Refseq | NM_001144757 |
Protein Refseq | NP_001138229 |
MIM | 173120 |
UniProt ID | P05408 |
◆ Recombinant Proteins | ||
Scg5-5709M | Recombinant Mouse Scg5 Protein, Myc/DDK-tagged | +Inquiry |
SCG5-7931M | Recombinant Mouse SCG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCG5-901C | Recombinant Cynomolgus SCG5 Protein, His-tagged | +Inquiry |
SCG5-10990Z | Recombinant Zebrafish SCG5 | +Inquiry |
SCG5-5251R | Recombinant Rat SCG5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCG5-2040HCL | Recombinant Human SCG5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCG5 Products
Required fields are marked with *
My Review for All SCG5 Products
Required fields are marked with *