Recombinant Human SCGB1C2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SCGB1C2-4619H
Product Overview : LOC653486 MS Standard C13 and N15-labeled recombinant protein (NP_001091079) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SCGB1C2 (Secretoglobin Family 1C Member 2) is a Protein Coding gene. Diseases associated with SCGB1C2 include Inflammatory Spondylopathy. An important paralog of this gene is SCGB1C1.
Molecular Mass : 10.3 kDa
AA Sequence : MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SCGB1C2 secretoglobin family 1C member 2 [ Homo sapiens (human) ]
Official Symbol SCGB1C2
Synonyms SCGB1C2; secretoglobin family 1C member 2; SCGB1C1; secretoglobin family 1C member 2; Secretoglobin RYD5; Secretoglobin family 1C member 1; secretoglobin, family 1C, member 1-like
Gene ID 653486
mRNA Refseq NM_001097610
Protein Refseq NP_001091079
UniProt ID P0DMR2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCGB1C2 Products

Required fields are marked with *

My Review for All SCGB1C2 Products

Required fields are marked with *

0
cart-icon
0
compare icon