Recombinant Human SCGB1C2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SCGB1C2-4619H |
| Product Overview : | LOC653486 MS Standard C13 and N15-labeled recombinant protein (NP_001091079) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | SCGB1C2 (Secretoglobin Family 1C Member 2) is a Protein Coding gene. Diseases associated with SCGB1C2 include Inflammatory Spondylopathy. An important paralog of this gene is SCGB1C1. |
| Molecular Mass : | 10.3 kDa |
| AA Sequence : | MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SCGB1C2 secretoglobin family 1C member 2 [ Homo sapiens (human) ] |
| Official Symbol | SCGB1C2 |
| Synonyms | SCGB1C2; secretoglobin family 1C member 2; SCGB1C1; secretoglobin family 1C member 2; Secretoglobin RYD5; Secretoglobin family 1C member 1; secretoglobin, family 1C, member 1-like |
| Gene ID | 653486 |
| mRNA Refseq | NM_001097610 |
| Protein Refseq | NP_001091079 |
| UniProt ID | P0DMR2 |
| ◆ Recombinant Proteins | ||
| SCGB1C2-462H | Recombinant Human SCGB1C2 Protein, MYC/DDK-tagged | +Inquiry |
| SCGB1C2-4619H | Recombinant Human SCGB1C2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB1C2 Products
Required fields are marked with *
My Review for All SCGB1C2 Products
Required fields are marked with *
