Recombinant Human SCGB1D2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SCGB1D2-5362H
Product Overview : SCGB1D2 MS Standard C13 and N15-labeled recombinant protein (NP_006542) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the lipophilin subfamily, part of the uteroglobin superfamily, and is an ortholog of prostatein, the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin gene products are widely expressed in normal tissues, especially in endocrine-responsive organs. Assuming that human lipophilins are the functional counterparts of prostatein, they may be transcriptionally regulated by steroid hormones, with the ability to bind androgens, other steroids and possibly bind and concentrate estramustine, a chemotherapeutic agent widely used for prostate cancer. Although the gene has been reported to be on chromosome 10, this sequence appears to be from a cluster of genes on chromosome 11 that includes mammaglobin 2.
Molecular Mass : 9.9 kDa
AA Sequence : MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SCGB1D2 secretoglobin family 1D member 2 [ Homo sapiens (human) ]
Official Symbol SCGB1D2
Synonyms SCGB1D2; secretoglobin, family 1D, member 2; secretoglobin family 1D member 2; LIPB; lipophilin B (uteroglobin family member); prostatein like; LPHB; prostatein like lipophilin B; lipophilin-B; prostatein-like lipophilin B;
Gene ID 10647
mRNA Refseq NM_006551
Protein Refseq NP_006542
MIM 615061
UniProt ID O95969

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCGB1D2 Products

Required fields are marked with *

My Review for All SCGB1D2 Products

Required fields are marked with *

0
cart-icon