Recombinant Human SCGB2A2 protein, His&Myc-tagged
| Cat.No. : | SCGB2A2-4424H | 
| Product Overview : | Recombinant Human SCGB2A2 protein(Q13296)(19-93aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&Myc | 
| Protein Length : | 19-93aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.  | 
                                
| Molecular Mass : | 37.5 kDa | 
| AA Sequence : | MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | SCGB2A2 secretoglobin, family 2A, member 2 [ Homo sapiens ] | 
| Official Symbol | SCGB2A2 | 
| Synonyms | SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1 , MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2; mammaglobin 1; mammaglobin-1; MGB1; | 
| Gene ID | 4250 | 
| mRNA Refseq | NM_002411 | 
| Protein Refseq | NP_002402 | 
| MIM | 605562 | 
| UniProt ID | Q13296 | 
| ◆ Recombinant Proteins | ||
| SCGB2A2-3687H | Recombinant Human SCGB2A2, His-tagged | +Inquiry | 
| SCGB2A2-4913R | Recombinant Rat SCGB2A2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| SCGB2A2-4424H | Recombinant Human SCGB2A2 protein, His&Myc-tagged | +Inquiry | 
| SCGB2A2-29237TH | Recombinant Human SCGB2A2, His-tagged | +Inquiry | 
| SCGB2A2-854H | Recombinant Human SCGB2A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SCGB2A2-2036HCL | Recombinant Human SCGB2A2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All SCGB2A2 Products
Required fields are marked with *
My Review for All SCGB2A2 Products
Required fields are marked with *
  
        
    
      
            