Recombinant Human SCGB2A2 protein, His&Myc-tagged
| Cat.No. : | SCGB2A2-4424H |
| Product Overview : | Recombinant Human SCGB2A2 protein(Q13296)(19-93aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-93aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.5 kDa |
| AA Sequence : | MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SCGB2A2 secretoglobin, family 2A, member 2 [ Homo sapiens ] |
| Official Symbol | SCGB2A2 |
| Synonyms | SCGB2A2; secretoglobin, family 2A, member 2; mammaglobin 1 , MGB1; mammaglobin-A; mammaglobin A; MGC71974; UGB2; mammaglobin 1; mammaglobin-1; MGB1; |
| Gene ID | 4250 |
| mRNA Refseq | NM_002411 |
| Protein Refseq | NP_002402 |
| MIM | 605562 |
| UniProt ID | Q13296 |
| ◆ Recombinant Proteins | ||
| SCGB2A2-4429HFL | Recombinant Full Length Human SCGB2A2 protein, Flag-tagged | +Inquiry |
| SCGB2A2-176H | Recombinant Human secretoglobin, family 2A, member 2 Protein, His&Flag tagged | +Inquiry |
| SCGB2A2-5254R | Recombinant Rat SCGB2A2 Protein | +Inquiry |
| SCGB2A2-524H | Recombinant Human SCGB2A2 protein, Fc/His-tagged | +Inquiry |
| SCGB2A2-672HFL | Recombinant Full Length Human SCGB2A2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGB2A2-2036HCL | Recombinant Human SCGB2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A2 Products
Required fields are marked with *
My Review for All SCGB2A2 Products
Required fields are marked with *
