Recombinant Human SCGN protein, GST-tagged
| Cat.No. : | SCGN-1821H |
| Product Overview : | Recombinant Human SCGN protein(1-276 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-276 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SCGN secretagogin, EF-hand calcium binding protein [ Homo sapiens ] |
| Official Symbol | SCGN |
| Synonyms | SCGN; secretagogin, EF-hand calcium binding protein; secretagogin; calbindin like; CALBL; DJ501N12.8; SECRET; SEGN; setagin; |
| Gene ID | 10590 |
| mRNA Refseq | NM_006998 |
| Protein Refseq | NP_008929 |
| MIM | 609202 |
| UniProt ID | O76038 |
| ◆ Recombinant Proteins | ||
| SCGN-1821H | Recombinant Human SCGN protein, GST-tagged | +Inquiry |
| SCGN-3974H | Recombinant Human SCGN protein(Asp2-Pro276), His-tagged | +Inquiry |
| Scgn-4580R | Recombinant Rat Secretagogin, EF-Hand Calcium Binding Protein, His-tagged | +Inquiry |
| Scgn-581M | Recombinant Mouse Scgn Protein, His-tagged | +Inquiry |
| SCGN-6487H | Recombinant Human SCGN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGN-1567HCL | Recombinant Human SCGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGN Products
Required fields are marked with *
My Review for All SCGN Products
Required fields are marked with *
