Recombinant Human SCGN Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SCGN-6487H |
| Product Overview : | SCGN MS Standard C13 and N15-labeled recombinant protein (NP_008929) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. |
| Molecular Mass : | 31.9 kDa |
| AA Sequence : | MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SCGN secretagogin, EF-hand calcium binding protein [ Homo sapiens (human) ] |
| Official Symbol | SCGN |
| Synonyms | SCGN; secretagogin, EF-hand calcium binding protein; secretagogin; calbindin like; CALBL; DJ501N12.8; SECRET; SEGN; setagin; |
| Gene ID | 10590 |
| mRNA Refseq | NM_006998 |
| Protein Refseq | NP_008929 |
| MIM | 609202 |
| UniProt ID | O76038 |
| ◆ Recombinant Proteins | ||
| SCGN-3740H | Recombinant Human SCGN, His-tagged | +Inquiry |
| SCGN-2531H | Recombinant Human SCGN, His-tagged | +Inquiry |
| Scgn-4580R | Recombinant Rat Secretagogin, EF-Hand Calcium Binding Protein, His-tagged | +Inquiry |
| SCGN-4914R | Recombinant Rat SCGN Protein, His (Fc)-Avi-tagged | +Inquiry |
| Scgn-581M | Recombinant Mouse Scgn Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGN-1567HCL | Recombinant Human SCGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGN Products
Required fields are marked with *
My Review for All SCGN Products
Required fields are marked with *
