Recombinant Human SCMH1, His-tagged
| Cat.No. : | SCMH1-28619TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 287-591 of Human SCMH1 Isoform 4 with N terminal His tag; Predicted MWt 35 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 287-591 a.a. |
| Description : | Polycomb protein SCMH1 is a protein that in humans is encoded by the SCMH1 gene. |
| Conjugation : | HIS |
| Tissue specificity : | Strongly expressed in heart, muscle and pancreas. Weakly expressed in brain, placenta, lung, liver and kidney. |
| Form : | Lyophilised:Reconstitute with 79 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TPEPDTSTVPQDAATIPSSAMQAPTVCIYLNKNGSTGPHL DKKKVQQLPDHFGPARASVVLQQAVQACIDCAYHQKTV FSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRF LEKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRY LPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHR PLLSSCGLPPSTASAVRRLCSRGSDRYLESRDASRLSG RDPSSWTVEDVMQFVREADPQLGPHADLFRKHEIDGKA LLLLRSDMMMKYMGLKLGPALKLSYHIDRLKQGKF |
| Sequence Similarities : | Belongs to the SCM family.Contains 2 MBT repeats.Contains 1 SAM (sterile alpha motif) domain. |
| Gene Name | SCMH1 sex comb on midleg homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | SCMH1 |
| Synonyms | SCMH1; sex comb on midleg homolog 1 (Drosophila); polycomb protein SCMH1; Scml3; |
| Gene ID | 22955 |
| mRNA Refseq | NM_001031694 |
| Protein Refseq | NP_001026864 |
| Uniprot ID | Q96GD3 |
| Chromosome Location | 1p34 |
| Function | DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| SCMH1-5587Z | Recombinant Zebrafish SCMH1 | +Inquiry |
| SCMH1-2534H | Recombinant Human SCMH1, GST-tagged | +Inquiry |
| SCMH1-28619TH | Recombinant Human SCMH1, His-tagged | +Inquiry |
| SCMH1-14750M | Recombinant Mouse SCMH1 Protein | +Inquiry |
| SCMH1-7935M | Recombinant Mouse SCMH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCMH1-2033HCL | Recombinant Human SCMH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCMH1 Products
Required fields are marked with *
My Review for All SCMH1 Products
Required fields are marked with *
