Recombinant Human SCN11A protein, His-tagged

• Cat.No.: SCN11A-3910H
• Product Overview: Recombinant Human SCN11A protein(812-1051 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 812-1051 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: NSFSNEERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVMEMKRGSETQEELGILTSVPKTLGVRHDWTWLAPLAEEEDDVEFSGEDNAQRITQPEPEQQAYELHQENKKPTSQRVQSVEIDMFSEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGWLPEMVPKKQPERCLPKGFGCCFPCCSVDKRKPPWVIWWNLRKTCYQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SCN11A sodium channel, voltage-gated, type XI, alpha subunit [ Homo sapiens ]
• Official Symbol: SCN11A
• Synonyms: SCN11A; sodium channel, voltage-gated, type XI, alpha subunit; SCN12A, sodium channel, voltage gated, type XI, alpha polypeptide , sodium channel, voltage gated, type XII, alpha; sodium channel protein type 11 subunit alpha; NaN; Nav1.9; SNS 2; PN5; hNaN; sensory neuron sodium channel 2; peripheral nerve sodium channel 5; voltage-gated sodium channel Nav1.9; sodium channel protein type XI subunit alpha; voltage-gated sodium channel subunit alpha Nav1.9; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XII, alpha polypeptide; SNS-2; NAV1.9; SCN12A
• Gene ID: 11280
• mRNA Refseq: NM_014139
• Protein Refseq: NP_054858
• MIM: 604385
• UniProt ID: Q9UI33