Recombinant Human SCN11A protein, His-tagged
Cat.No. : | SCN11A-3910H |
Product Overview : | Recombinant Human SCN11A protein(812-1051 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 812-1051 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NSFSNEERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVMEMKRGSETQEELGILTSVPKTLGVRHDWTWLAPLAEEEDDVEFSGEDNAQRITQPEPEQQAYELHQENKKPTSQRVQSVEIDMFSEDEPHLTIQDPRKKSDVTSILSECSTIDLQDGFGWLPEMVPKKQPERCLPKGFGCCFPCCSVDKRKPPWVIWWNLRKTCYQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SCN11A sodium channel, voltage-gated, type XI, alpha subunit [ Homo sapiens ] |
Official Symbol | SCN11A |
Synonyms | SCN11A; sodium channel, voltage-gated, type XI, alpha subunit; SCN12A, sodium channel, voltage gated, type XI, alpha polypeptide , sodium channel, voltage gated, type XII, alpha; sodium channel protein type 11 subunit alpha; NaN; Nav1.9; SNS 2; PN5; hNaN; sensory neuron sodium channel 2; peripheral nerve sodium channel 5; voltage-gated sodium channel Nav1.9; sodium channel protein type XI subunit alpha; voltage-gated sodium channel subunit alpha Nav1.9; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XII, alpha polypeptide; SNS-2; NAV1.9; SCN12A; |
Gene ID | 11280 |
mRNA Refseq | NM_014139 |
Protein Refseq | NP_054858 |
MIM | 604385 |
UniProt ID | Q9UI33 |
◆ Recombinant Proteins | ||
SCN11A-5259R | Recombinant Rat SCN11A Protein | +Inquiry |
SCN11A-14752M | Recombinant Mouse SCN11A Protein | +Inquiry |
SCN11A-7937M | Recombinant Mouse SCN11A Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN11A-3910H | Recombinant Human SCN11A protein, His-tagged | +Inquiry |
SCN11A-4918R | Recombinant Rat SCN11A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCN11A Products
Required fields are marked with *
My Review for All SCN11A Products
Required fields are marked with *
0
Inquiry Basket