Recombinant Human SCN2B
Cat.No. : | SCN2B-31351TH |
Product Overview : | Recombinant full length Human Scn2b with N terminal proprietary tag; Predicted MWt 49.76 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 215 amino acids |
Description : | Sodium channel subunit beta-2 is a protein that in humans is encoded by the SCN2B gene. |
Molecular Weight : | 49.760kDa inclusive of tags |
Tissue specificity : | Brain specific. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNV LNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMF LQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV IVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE EGKTDGEGNPDDGAK |
Sequence Similarities : | Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
Gene Name | SCN2B sodium channel, voltage-gated, type II, beta [ Homo sapiens ] |
Official Symbol | SCN2B |
Synonyms | SCN2B; sodium channel, voltage-gated, type II, beta; sodium channel, voltage gated, type II, beta polypeptide; sodium channel subunit beta-2; |
Gene ID | 6327 |
mRNA Refseq | NM_004588 |
Protein Refseq | NP_004579 |
MIM | 601327 |
Uniprot ID | O60939 |
Chromosome Location | 11q22-qter |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; |
Function | voltage-gated ion channel activity; voltage-gated sodium channel activity; |
◆ Recombinant Proteins | ||
SCN2B-5263R | Recombinant Rat SCN2B Protein | +Inquiry |
SCN2B-4100R | Recombinant Rhesus monkey SCN2B Protein, His-tagged | +Inquiry |
RFL18899HF | Recombinant Full Length Human Sodium Channel Subunit Beta-2(Scn2B) Protein, His-Tagged | +Inquiry |
SCN2B-3917R | Recombinant Rhesus Macaque SCN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32011RF | Recombinant Full Length Rat Sodium Channel Subunit Beta-2(Scn2B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCN2B-1280HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
SCN2B-975HCL | Recombinant Human SCN2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCN2B Products
Required fields are marked with *
My Review for All SCN2B Products
Required fields are marked with *