Recombinant Human SCN3B protein, GST-tagged
Cat.No. : | SCN3B-301194H |
Product Overview : | Recombinant Human SCN3B (23-93 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Phe23-Gln93 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SCN3B sodium voltage-gated channel beta subunit 3 [ Homo sapiens (human) ] |
Official Symbol | SCN3B |
Synonyms | SCNB3; ATFB16; BRGDA7; HSA243396 |
Gene ID | 55800 |
mRNA Refseq | NM_001040151 |
Protein Refseq | NP_001035241 |
MIM | 608214 |
UniProt ID | Q9NY72 |
◆ Recombinant Proteins | ||
SCN3B-4924R | Recombinant Rat SCN3B Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN3B-3880H | Recombinant Human SCN3B protein, His-tagged | +Inquiry |
SCN3B-5174Z | Recombinant Zebrafish SCN3B | +Inquiry |
SCN3B-645C | Recombinant Cynomolgus Monkey SCN3B Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN3B-3918R | Recombinant Rhesus Macaque SCN3B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCN3B-1454HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
SCN3B-1589HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCN3B Products
Required fields are marked with *
My Review for All SCN3B Products
Required fields are marked with *
0
Inquiry Basket