Recombinant Human SCN3B protein, GST-tagged
| Cat.No. : | SCN3B-301194H |
| Product Overview : | Recombinant Human SCN3B (23-93 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Phe23-Gln93 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | SCN3B sodium voltage-gated channel beta subunit 3 [ Homo sapiens (human) ] |
| Official Symbol | SCN3B |
| Synonyms | SCNB3; ATFB16; BRGDA7; HSA243396 |
| Gene ID | 55800 |
| mRNA Refseq | NM_001040151 |
| Protein Refseq | NP_001035241 |
| MIM | 608214 |
| UniProt ID | Q9NY72 |
| ◆ Recombinant Proteins | ||
| Scn3b-5716M | Recombinant Mouse Scn3b Protein, Myc/DDK-tagged | +Inquiry |
| SCN3B-5265R | Recombinant Rat SCN3B Protein | +Inquiry |
| SCN3B-459H | Recombinant Human SCN3B Protein, MYC/DDK-tagged | +Inquiry |
| SCN3B-3918R | Recombinant Rhesus Macaque SCN3B Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCN3B-545H | Recombinant Human SCN3B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCN3B-1454HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
| SCN3B-1589HCL | Recombinant Human SCN3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCN3B Products
Required fields are marked with *
My Review for All SCN3B Products
Required fields are marked with *
