Recombinant Human SCNM1, His-tagged
| Cat.No. : | SCNM1-30295TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1-226 of Human SCNM1 with N terminal His tag; MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-226 a.a. |
| Description : | SCNM1 is a zinc finger protein and putative splicing factor. In mice, Scnm1 modifies phenotypic expression of Scn8a (MIM 600702) mutations (Buchner et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDG RFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGK KQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQS ALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQ SGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYL TLRSSGWIPDGRGRWVKDENVEFDSDEEEPPD |
| Gene Name | SCNM1 sodium channel modifier 1 [ Homo sapiens ] |
| Official Symbol | SCNM1 |
| Synonyms | SCNM1; sodium channel modifier 1; MGC3180; |
| Gene ID | 79005 |
| mRNA Refseq | NM_001204856 |
| Protein Refseq | NP_001191785 |
| MIM | 608095 |
| Uniprot ID | Q9BWG6 |
| Chromosome Location | 1q21.3 |
| Function | metal ion binding; |
| ◆ Recombinant Proteins | ||
| SCNM1-2538H | Recombinant Human SCNM1, GST-tagged | +Inquiry |
| SCNM1-30295TH | Recombinant Human SCNM1, His-tagged | +Inquiry |
| SCNM1-4102R | Recombinant Rhesus monkey SCNM1 Protein, His-tagged | +Inquiry |
| SCNM1-3919R | Recombinant Rhesus Macaque SCNM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCNM1-228Z | Recombinant Zebrafish SCNM1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCNM1-2029HCL | Recombinant Human SCNM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCNM1 Products
Required fields are marked with *
My Review for All SCNM1 Products
Required fields are marked with *
