Recombinant Human SCO2 protein, His-tagged
Cat.No. : | SCO2-3149H |
Product Overview : | Recombinant Human SCO2 protein(NP_001162580)(1-266 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-266 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SCO2 SCO cytochrome oxidase deficient homolog 2 (yeast) [ Homo sapiens ] |
Official Symbol | SCO2 |
Synonyms | SCO2; SCO cytochrome oxidase deficient homolog 2 (yeast); SCO (cytochrome oxidase deficient, yeast) homolog 2; protein SCO2 homolog, mitochondrial; SCO1L; cytochrome oxidase deficient homolog 2; MGC125823; MGC125825; |
Gene ID | 9997 |
mRNA Refseq | NM_001169109 |
Protein Refseq | NP_001162580 |
MIM | 604272 |
UniProt ID | O43819 |
◆ Recombinant Proteins | ||
SCO2-4247Z | Recombinant Zebrafish SCO2 | +Inquiry |
SCO2-14770M | Recombinant Mouse SCO2 Protein | +Inquiry |
SCO2-3473H | Recombinant Human SCO2 protein, His-SUMO-tagged | +Inquiry |
SCO2-3449H | Recombinant Human SCO2 protein, His-tagged | +Inquiry |
Sco2-170H | Recombinant Human SCO2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCO2-2025HCL | Recombinant Human SCO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCO2 Products
Required fields are marked with *
My Review for All SCO2 Products
Required fields are marked with *
0
Inquiry Basket