Recombinant Human SCP2 protein, GST-tagged
| Cat.No. : | SCP2-7865H |
| Product Overview : | Recombinant Human SCP2 protein(405-547 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 405-547 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SCP2 sterol carrier protein 2 [ Homo sapiens ] |
| Official Symbol | SCP2 |
| Synonyms | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; sterol carrier protein X; propanoyl-CoA C-acyltransferase; NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI; DKFZp686C12188; DKFZp686D11188; |
| Gene ID | 6342 |
| mRNA Refseq | NM_001007098 |
| Protein Refseq | NP_001007099 |
| MIM | 184755 |
| UniProt ID | P22307 |
| ◆ Recombinant Proteins | ||
| Scp2-8099R | Recombinant Rat Scp2 protein, His & T7-tagged | +Inquiry |
| SCP2-7865H | Recombinant Human SCP2 protein, GST-tagged | +Inquiry |
| SCP2-4934R | Recombinant Rat SCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCP2-1239H | Recombinant Human SCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Scp2-2045M | Recombinant Mouse Scp2 Protein, His&GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCP2 Products
Required fields are marked with *
My Review for All SCP2 Products
Required fields are marked with *



