Recombinant Human SCP2 protein, GST-tagged
Cat.No. : | SCP2-7865H |
Product Overview : | Recombinant Human SCP2 protein(405-547 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 405-547 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SCP2 sterol carrier protein 2 [ Homo sapiens ] |
Official Symbol | SCP2 |
Synonyms | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; sterol carrier protein X; propanoyl-CoA C-acyltransferase; NLTP; SCPX; SCP-2; SCP-X; NSL-TP; SCP-CHI; DKFZp686C12188; DKFZp686D11188; |
Gene ID | 6342 |
mRNA Refseq | NM_001007098 |
Protein Refseq | NP_001007099 |
MIM | 184755 |
UniProt ID | P22307 |
◆ Recombinant Proteins | ||
SCP2-2477H | Recombinant Human SCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCP2-459HF | Recombinant Full Length Human SCP2 Protein | +Inquiry |
Scp2-809R | Recombinant Rat Scp2 protein(1-547aa), His-tagged | +Inquiry |
Scp2-5720M | Recombinant Mouse Scp2 Protein, Myc/DDK-tagged | +Inquiry |
SCP2-31466TH | Recombinant Human SCP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCP2 Products
Required fields are marked with *
My Review for All SCP2 Products
Required fields are marked with *
0
Inquiry Basket