Recombinant Human SCP2D1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SCP2D1-1169H |
Product Overview : | C20orf79 MS Standard C13 and N15-labeled recombinant protein (NP_848578) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SCP2D1 (SCP2 Sterol Binding Domain Containing 1) is a Protein Coding gene. Diseases associated with SCP2D1 include Corneal Dystrophy, Posterior Polymorphous, 1 and D-Bifunctional Protein Deficiency. An important paralog of this gene is SCP2. |
Molecular Mass : | 17.7 kDa |
AA Sequence : | MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SCP2D1 SCP2 sterol binding domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | SCP2D1 |
Synonyms | SCP2D1; SCP2 sterol binding domain containing 1; HSD22; C20orf79; dJ1068E13.2; SCP2 sterol-binding domain-containing protein 1; sterol carrier protein 2-like protein |
Gene ID | 140856 |
mRNA Refseq | NM_178483 |
Protein Refseq | NP_848578 |
UniProt ID | Q9UJQ7 |
◆ Recombinant Proteins | ||
SCP2D1-5125H | Recombinant Human SCP2D1, His-tagged | +Inquiry |
SCP2D1-1306H | Recombinant Human SCP2D1 | +Inquiry |
SCP2D1-4103R | Recombinant Rhesus monkey SCP2D1 Protein, His-tagged | +Inquiry |
SCP2D1-1169H | Recombinant Human SCP2D1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCP2D1-524H | Recombinant Human SCP2 sterol-binding domain containing 1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCP2D1 Products
Required fields are marked with *
My Review for All SCP2D1 Products
Required fields are marked with *