Recombinant Human SCP2D1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SCP2D1-1169H
Product Overview : C20orf79 MS Standard C13 and N15-labeled recombinant protein (NP_848578) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SCP2D1 (SCP2 Sterol Binding Domain Containing 1) is a Protein Coding gene. Diseases associated with SCP2D1 include Corneal Dystrophy, Posterior Polymorphous, 1 and D-Bifunctional Protein Deficiency. An important paralog of this gene is SCP2.
Molecular Mass : 17.7 kDa
AA Sequence : MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SCP2D1 SCP2 sterol binding domain containing 1 [ Homo sapiens (human) ]
Official Symbol SCP2D1
Synonyms SCP2D1; SCP2 sterol binding domain containing 1; HSD22; C20orf79; dJ1068E13.2; SCP2 sterol-binding domain-containing protein 1; sterol carrier protein 2-like protein
Gene ID 140856
mRNA Refseq NM_178483
Protein Refseq NP_848578
UniProt ID Q9UJQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCP2D1 Products

Required fields are marked with *

My Review for All SCP2D1 Products

Required fields are marked with *

0
cart-icon