Recombinant Human SCP2D1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SCP2D1-1169H
• Product Overview: C20orf79 MS Standard C13 and N15-labeled recombinant protein (NP_848578) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SCP2D1 (SCP2 Sterol Binding Domain Containing 1) is a Protein Coding gene. Diseases associated with SCP2D1 include Corneal Dystrophy, Posterior Polymorphous, 1 and D-Bifunctional Protein Deficiency. An important paralog of this gene is SCP2.
• Molecular Mass: 17.7 kDa
• AA Sequence: MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SCP2D1 SCP2 sterol binding domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: SCP2D1
• Synonyms: SCP2D1; SCP2 sterol binding domain containing 1; HSD22; C20orf79; dJ1068E13.2; SCP2 sterol-binding domain-containing protein 1; sterol carrier protein 2-like protein
• Gene ID: 140856
• mRNA Refseq: NM_178483
• Protein Refseq: NP_848578
• UniProt ID: Q9UJQ7