Recombinant Human SDC2 protein(61-140 aa), C-His-tagged
Cat.No. : | SDC2-2728H |
Product Overview : | Recombinant Human SDC2 protein(P34741)(61-140 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-140 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLF |
Gene Name | SDC2 syndecan 2 [ Homo sapiens ] |
Official Symbol | SDC2 |
Synonyms | SDC2; syndecan 2; heparan sulfate proteoglycan 1, cell surface associated , HSPG, HSPG1; syndecan-2; CD362; fibroglycan; SYND2; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated; HSPG; HSPG1; |
Gene ID | 6383 |
mRNA Refseq | NM_002998 |
Protein Refseq | NP_002989 |
MIM | 142460 |
UniProt ID | P34741 |
◆ Recombinant Proteins | ||
SDC2-501H | Active Recombinant Human Syndecan 2, His-tagged | +Inquiry |
SDC2-1445H | Recombinant Human SDC2 Protein (Glu19-Glu144), His tagged | +Inquiry |
SDC2-529R | Recombinant Rat SDC2 Protein, Fc-tagged | +Inquiry |
SDC2-2836H | Recombinant Human SDC2 protein, His-tagged | +Inquiry |
SDC2-127H | Recombinant Human SDC2 Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDC2-1575HCL | Recombinant Human SDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDC2 Products
Required fields are marked with *
My Review for All SDC2 Products
Required fields are marked with *
0
Inquiry Basket