Recombinant Human SDC2 protein(61-140 aa), C-His-tagged

• Cat.No.: SDC2-2728H
• Product Overview: Recombinant Human SDC2 protein(P34741)(61-140 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 61-140 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLF

Gene Information

• Gene Name: SDC2 syndecan 2 [ Homo sapiens ]
• Official Symbol: SDC2
• Synonyms: SDC2; syndecan 2; heparan sulfate proteoglycan 1, cell surface associated , HSPG, HSPG1; syndecan-2; CD362; fibroglycan; SYND2; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated; HSPG; HSPG1
• Gene ID: 6383
• mRNA Refseq: NM_002998
• Protein Refseq: NP_002989
• MIM: 142460
• UniProt ID: P34741