Recombinant Human SDC2 protein, His-tagged
| Cat.No. : | SDC2-2836H |
| Product Overview : | Recombinant Human SDC2 protein(20-147 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 20-147 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SDC2 syndecan 2 [ Homo sapiens ] |
| Official Symbol | SDC2 |
| Synonyms | SDC2; syndecan 2; heparan sulfate proteoglycan 1, cell surface associated , HSPG, HSPG1; syndecan-2; CD362; fibroglycan; SYND2; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated; HSPG; HSPG1; |
| Gene ID | 6383 |
| mRNA Refseq | NM_002998 |
| Protein Refseq | NP_002989 |
| MIM | 142460 |
| UniProt ID | P34741 |
| ◆ Recombinant Proteins | ||
| SDC2-213H | Recombinant Human SDC2 Protein, His-tagged | +Inquiry |
| RFL16761RF | Recombinant Full Length Rat Syndecan-2(Sdc2) Protein, His-Tagged | +Inquiry |
| SDC2-1445H | Recombinant Human SDC2 Protein (Glu19-Glu144), His tagged | +Inquiry |
| SDC2-3923R | Recombinant Rhesus Macaque SDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SDC2-4034H | Recombinant Human SDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SDC2-1575HCL | Recombinant Human SDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDC2 Products
Required fields are marked with *
My Review for All SDC2 Products
Required fields are marked with *
